Natural Inspired Marquise Emerald Leaf Earrings with Screw Back

0
Regular price $319
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Embrace the magic of nature inspired elegance with these stunning Leaf Earrings, designed to bring a fresh, graceful touch to your everyday style. Each earring showcases a Leaf motif, highlighted by a tilted 2X4mm Marquise Shape Emerald set in Prong Setting that adds a charming pop of color. The rich green stone catches the light effortlessly, creating an eye-catching sparkle. Crafted with comfort in mind, the secure Screw Back Closure makes these Emerald Earrings perfect for all-day wear. Thoughtfully packaged in a chic jewelry box, these May Birthstone Earrings are ready to gift for birthdays, Thanksgiving or Christmas. Whether you are dressing up for a festive gathering or adding a hint of sophistication to your daily style, these Emerald Stud Earrings offer a refreshing blend of simplicity, charm and modern appeal. Let this pair be your new go-to accessory for moments that call for something unique and delightfully chic.

Product Information
SKU SHP-EARRINGS112122763
Length 7 mm
Width 4.5 mm
Height 1.5 mm
Metal Weight 0.90 gm (Approximate)
Total Stone Weight 0.24 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 2 Pieces
Total Weight 0.24 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-2 Pcs
Color Green
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade AAA
View More