Natural Emerald Diamond Swirl Earrings with Screw Back

0
Regular price $1,299
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add a pop of vibrant elegance to your everyday style with these Swirl Earrings, designed to bring movement, sparkle and personality to any look. At the center of each earring is a radiant 5 mm Round Shape Emerald, glowing with rich green color, beautifully framed by a swirling design adorned with shimmering Diamond stones. The swirl motif adds a graceful flow that feels both artistic and modern, creating a striking balance between bold color and delicate shine. With secure Screw Back Closure, these Emerald Diamond Earrings offer all-day comfort and confidence, whether you are heading to a special event or simply elevating a casual outfit. Their unique shape makes them incredibly versatile, perfect for pairing with classy evening wear, chic office attire or everyday basics that need a touch of sparkle. Arriving in a lovely jewelry box, these Emerald Ear Studs also make a meaningful and stylish gift for someone who loves distinctive designs with timeless charm. These Emerald Earrings for Women bring a refreshing blend of sophistication and playfulness, making them a beautiful choice for anyone who wants to stand out with elegance and effortless flair.

Product Information
SKU SHP-EARRINGS112115151
Length 9 mm
Width 9.2 mm
Height 3.5 mm
Metal Weight 2.20 gm (Approximate)
Total Stone Weight 1.29 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 2 Pieces
Total Weight 0.99 Carat (Approximate)
Dimension(approx) Round-5X5 mm-2 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 74 Pieces
Total Weight 0.30 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-4 Pcs
Round-0.90X0.90 mm-70 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More