Lab Grown Emerald Diamond Infinity Necklace

0
Regular price $369
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbolic Necklace with Elegant Meaning

This lab grown emerald and diamond infinity necklace is designed for those who value meaningful jewelry with a refined aesthetic. The infinity motif represents continuity and connection, making it a thoughtful choice for personal wear or gifting.

Its balanced form allows it to complement both everyday outfits and special occasions.

Infinity Design with Balanced Detailing

The infinity shape creates a fluid and continuous design, offering a harmonious visual flow. Diamonds are set along the structure to introduce subtle brilliance, enhancing the overall appearance without overwhelming the form.

The setting is crafted to maintain both visual clarity and secure placement of each stone.

Lab Grown Emerald and Diamond Appeal

Lab grown emerald provides a vivid green tone with consistent clarity, making it a practical option for fine jewelry. It is created without traditional mining, while the environmental impact varies by production and energy source.

Diamond accents contribute additional sparkle, complementing the center element with refined brilliance.

Designed for Everyday Wear

This necklace is designed to sit comfortably along the neckline, offering a lightweight feel for extended wear. Its structure supports ease of movement while maintaining its elegant appearance.

It can be worn alone as a statement or layered with other pieces for a personalized style.

Product Information
SKU SHP-PENDANT112310248
Weight 2.43 gm (Approximate)
Center Stone Weight 2.50 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 2.50 Carat (Approximate)
Dimension(approx) Pear-8X10 mm-1 Pcs
Color Green
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 12 Pieces
Total Weight 0.07 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-12 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
lab-created-emerald-necklace

FAQs About: Lab Grown Emerald and Diamond Infinity Necklace

Is this necklace suitable for everyday wear?
Yes, its lightweight and balanced design make it suitable for daily wear.
What does the infinity symbol represent?
The infinity symbol represents continuity, connection, and lasting meaning.
Is lab grown emerald a good choice for jewelry?
Yes, it offers consistent clarity and vibrant color, making it suitable for regular use.
Can this necklace be layered with others?
Yes, its simple and elegant design makes it easy to layer with other necklaces.
Do diamond accents add noticeable sparkle?
Yes, diamond accents enhance the design by adding subtle brilliance.
How should this necklace be cared for?
Clean gently with a soft cloth and store separately to maintain its condition.