Flower Inspired Moissanite Proposal Ring for Women

0
Regular price $359
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Moissanite Promise Ring for Her brings together delicate design and meaningful symbolism. At the center, a sparkling 5 MM round moissanite shines with clarity and brilliance, cradled by prongs and surrounded by smooth flower petals. The flower motif adds a romantic, nature-inspired touch, making the Flower Ring feel tender and full of heart. The unique band wraps gently around the finger, creating a graceful flow that draws attention to the center stone, while a line of small round moissanites set in bypass style, that catch the light with every movement. Elegant yet easy to wear, this Moissanite Ring for Women carries a quiet charm that makes it perfect for everyday moments or personal milestones. It is a thoughtful choice for a promise ring, a gift to yourself, or a sweet surprise for someone you love. Designed to feel lightweight and comfortable, this Flower Promise Ring is available in a wide range of sizes. Its timeless floral design and brilliant sparkle make it a beautiful reminder of love that's blooming, steady, pure, and full of promise.

Product Information
SKU SHP-RINGS032220601
Metal Weight 2.40 gm (Approximate)
Center Stone Weight 0.52 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 21 Pieces
Total Weight 0.72 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-20 Pcs
Round-5X5 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type 4-Prong-Diagonal-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings