Diamond Nature Inspired Earring for Helix Piercing

0
Regular price $429
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

A slender leaf motif gives this diamond helix earring its fresh, nature-inspired character. Made for curated ear styling, the design brings a small flash of sparkle to the helix, cartilage, or upper lobe with a graceful botanical shape rather than a traditional stud look. Its delicate scale and single-ear format make it a thoughtful choice for a personal style upgrade, birthday gift, or meaningful milestone piece for someone who loves refined body jewelry with a soft organic feel.

Diamond Nature Inspired Helix Earring with Flat Back

This single diamond helix earring is crafted in hallmarked precious metal and set with round brilliant diamonds along a leaf-inspired design. Four round diamonds create a subtle line of sparkle, while the prong setting keeps the stones neatly secured within the petite silhouette. A flat back closure helps the earring stay comfortably in place for helix, cartilage, and upper lobe piercings, with selectable post lengths for a more personalized fit.

What Makes This Special

The design is set with 4 round brilliant diamonds, each measuring approximately 1 x 1 mm, with an approximate total diamond weight of 0.02 carat. The diamonds are arranged on the leaf motif to create a fine, light-catching accent rather than an oversized sparkle statement.

The diamond details include round shape, brilliant cut, prong setting, HI color, and SI quality grade. The selectable gemstone quality options include Lab - EF-VS and Natural - HI-SI, allowing the buyer to choose a preferred diamond type.

The earring has an approximate metal weight of 0.45 gram and is sold singly. It is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold, with flat back post length options from 4.5 mm to 7.5 mm.

Why Choose This Design

The leaf shape brings a softer, more expressive look to body jewelry, making it ideal for shoppers who want something more distinctive than a plain round stud. Its slim profile works well in a curated ear stack because it adds movement and shape without overwhelming nearby earrings.

The round brilliant diamonds provide controlled sparkle in a compact design, while the prong setting helps keep the stones visible and secure. The flat back closure is especially suited to cartilage jewelry because it creates a smoother finish behind the ear, making the piece practical for regular wear when properly fitted.

Design Meaning

A leaf design naturally connects with growth, renewal, individuality, and personal transformation. That makes this diamond helix earring a meaningful gift for a new chapter, a self-celebration, or a style moment that marks confidence and change. The petite diamond accents add a quiet sense of celebration, giving the organic form a polished jewelry finish.

Authenticity & Craftsmanship

Rosec Jewels crafts this diamond leaf earring with attention to stone placement, setting security, and refined finishing. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch, helping ensure the earring is prepared with care for its intended piercing placement. Rosec Jewels offers a Certificate of Authenticity with the product for added confidence. To maintain its shine, avoid harsh chemicals, store it separately when not in use, and clean it gently with a soft cloth as part of regular jewelry care.

Style and Wearability

This single leaf earring is easy to style as a helix accent, cartilage stud, or upper lobe detail. It can be worn alone for a minimal botanical sparkle or paired with hoops, studs, and other flat back earrings for a curated ear look. The yellow and white gold options make it simple to coordinate with existing jewelry, while the selectable post length supports a more comfortable fit for different piercing placements.

Product Information
SKU SHP-BODYJ012410027
Metal Weight 0.45 gm (Approximate)
Total Stone Weight 0.02 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 4 Pieces
Total Weight 0.02 Carat (Approximate)
Dimension(approx) Round-1X1 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Diamond Nature Inspired Earring for Helix Piercing

What type of piercing is this diamond leaf earring designed for?

This single diamond earring is designed for helix, cartilage, and upper lobe piercings. It has a flat back closure that helps the earring sit securely and comfortably in the chosen piercing.

How many diamonds are set in this helix earring?

The earring is set with 4 round brilliant diamonds in prong settings. The total diamond weight is approximately 0.02 carat, with each round diamond measuring approximately 1 x 1 mm.

What does the nature-inspired leaf design symbolize?

The leaf design symbolizes growth, renewal, individuality, and fresh beginnings. Its delicate botanical shape makes it a meaningful choice for a personal milestone, self-gift, or thoughtful jewelry present.

Which diamond quality options are available?

The selectable gemstone quality options include Lab - EF-VS and Natural - HI-SI. The diamond details also include round shape, brilliant cut, prong setting, HI color, and SI quality grade.

What metal options can I choose for this earring?

This earring is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. These options allow the piece to coordinate with warm or cool-toned jewelry stacks.

Is this earring sold as a single piece or a pair?

This diamond nature-inspired earring is sold singly. It is intended for curated ear styling, where one helix, cartilage, or upper lobe accent can be mixed with other earrings.

Does this diamond helix earring come with authenticity assurance?

Rosec Jewels offers a Certificate of Authenticity with the earring. The piece also goes through stone inspection, setting security review, and finishing inspection before dispatch.