Antique Style Natural Peridot and Diamond Flower Pendant for Women

0
Regular price $449
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Enhance your jewelry collection with a vintage inspired addition - this beautiful Peridot Flower Pendant. Crafted in a lovely floral shape, it showcases a 5 MM round peridot at its center. Surrounding this central gem are sparkling round cut diamonds, arranged like delicate petals, which create a charming flower-inspired design. All the stones are securely held in prong settings, ensuring they stay firmly in place while allowing for a detailed appearance. Made with AAA quality peridot and HI-SI quality real diamonds, this Floral Pendant Necklace presents a stunning blend of color and brilliance. The antique style floral motif imparts a feminine and graceful touch, making it ideal for both casual wear and special occasions. The Peridot and Diamond Pendant can be paired with an optional chain, allowing you to select the look that best suits you. It also arrives carefully packaged in a jewelry box, making it ready for gifting. With various metal color options and purities available, you can choose the one that aligns with your personal taste. As a piece featuring the August birthstone, this Antique Peridot Necklace serves as a meaningful gift for birthdays, anniversaries, or any special occasion.

Product Information
SKU SHP-PENDANT102024938
Length 15.5 mm
Width 10.5 mm
Metal Weight 4.50 gm (Approximate)
Total Stone Weight 0.65 Carat (Approximate)
PERIDOT INFORMATION
No.of Stones 1 Pieces
Total Weight 0.54 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.11 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-8 Pcs
Round-1.10X1.10 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
peridot-necklaces