8.5 CT Bead Set Freshwater Pearl and Diamond Heart Dangle Pendant Necklace

0
Regular price $679
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Embrace a heart full of love and compassion with this stunning Freshwater Pearl Heart Pendant, featuring a perfectly round freshwater pearl nestled within a heart-shaped motif, adorned with sparkling Diamond accents at its pinnacle. This solid gold pendant is guaranteed to elevate your style quotient to new heights. With a total weight of 8.50 Carat and a superior AAA quality rating, this Pendant is a true testament to our commitment to excellence. All of our gemstones are certified and undergo rigorous quality checks to ensure their authenticity and value.

Product Information
SKU SHP-PENDANT042210115
Metal Weight 3.80 gm (Approximate)
Total Stone Weight 8.32 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 8.00 Carat (Approximate)
Dimension(approx) Round-10X10 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 19 Pieces
Total Weight 0.32 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-4 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-6 Pcs
Round-1.50X1.50 mm-5 Pcs
Round-1.60X1.60 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
freshwater-pearl-necklaces