Unique Diamond Triangle Helix Drop Earring with Black Enamel

0
Regular price $499
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Designed for a curated ear with sharp geometry and a touch of drama, this unique diamond triangle helix drop earring brings together black enamel, polished gold, and a single round diamond drop. The triangle motif gives the piece a bold modern edge, while the diamond adds a refined point of sparkle below it. Sold singly, it is made for helix styling, cartilage placement, asymmetric ear stacks, or a distinctive gift for someone who loves jewelry with personality.

Unique Diamond Triangle Helix Drop Earring

This helix earring is crafted with one round natural diamond weighing approximately 0.09 carat. The diamond measures approximately 2.40 x 2.40 mm, is brilliant cut, HI color, SI quality grade, and secured in a prong setting. A gold triangle shape decorated with black enamel gives the design its graphic character, while flat back post length options and left or right ear selections make it suitable for a personalized piercing fit.

What Makes This Special

The earring features one round diamond with an approximate total weight of 0.09 carat. The stone measures approximately 2.40 x 2.40 mm and is set as a small drop beneath the triangle design for a clean, light-catching finish.

The diamond is round in shape, brilliant cut, HI in color, SI quality grade, and secured in a prong setting. The black enamel triangle brings contrast and modern structure, making the piece stand out from traditional helix studs.

The earring has an approximate weight of 0.45 gm and is sold singly. Metal options include 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. Flat back post length options include 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm, with left ear and right ear selections available.

Why Choose This Design

The triangle shape gives this helix earring a clean, architectural look, while the black enamel adds depth and contrast against the gold. That combination makes the design feel bold without becoming heavy, ideal for shoppers who want piercing jewelry with a sharper fashion identity.

The single diamond drop softens the geometric profile with movement and sparkle. Its prong setting keeps the round brilliant diamond visible, while the flat back post supports comfortable wear in helix and cartilage placements.

Design Meaning

Triangles often suggest strength, balance, direction, and individuality. Paired with black enamel, the motif feels confident and expressive, while the diamond drop adds a sense of light and refinement. This earring is a meaningful choice for someone who sees jewelry as self-expression and wants a piece that feels modern, symbolic, and personal.

Authenticity & Craftsmanship

Each earring is carefully crafted with attention to diamond placement, prong setting security, enamel detail, flat back comfort, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase experience. Before dispatch, every piece goes through stone inspection, setting security review, and finishing inspection to help ensure it is ready for styling or gifting. For lasting care, store it separately, avoid harsh chemicals and abrasive contact with the enamel, and wipe it gently with a soft cloth after wear.

Style and Wearability

This diamond triangle helix drop earring adds a graphic accent to a curated ear stack while staying refined enough for regular styling. Wear it alone for a statement helix detail, or pair it with diamond studs, plain gold flat backs, tiny hoops, black enamel jewelry, and minimalist cartilage earrings. Its single-piece format makes asymmetric styling easy, while the metal and post length options help tailor the piece to your preferred look and fit.

Product Information
SKU SHP-BODYJ082210046
Weight 0.45 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.09 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
helix-earrings

FAQs About: Unique Diamond Triangle Helix Drop Earring with Black Enamel

What makes this diamond triangle helix earring unique?

The earring combines a gold triangle shape decorated with black enamel and a round diamond drop. This gives the piece a bold geometric look with a small, refined point of sparkle.

What diamond is used in this helix drop earring?

The earring features one round natural diamond measuring approximately 2.40 x 2.40 mm. The diamond has an approximate weight of 0.09 carat.

What cut, color, and quality are listed for the diamond?

The diamond is round in shape with brilliant cut faceting. It is listed as HI color and SI quality grade.

What setting and closure style does this earring have?

The round diamond is secured in a prong setting. The earring is designed with a flat back post, with multiple post length options available for a more personalized fit.

Is this earring sold as a single piece or a pair?

This earring is sold singly. Left ear and right ear selections are available, making it suitable for one piercing or an asymmetric curated ear look.

What metal and post length options are available?

The earring is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. Flat back post length options include 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm.

How should I care for this black enamel diamond helix earring?

Store the earring separately to help prevent scratches, avoid harsh chemicals, and wipe it gently with a soft cloth after wear. To protect the enamel detail, avoid abrasive cleaning, hard impact, and prolonged exposure to cosmetics or perfumes.