Round Shape Black Onyx and Diamond Sunburst Stud Earrings

0
Regular price $399
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Black Onyx and Diamond Sunburst Stud Earrings

These stud earrings feature round black onyx gemstones placed at the center of a sunburst-inspired design. The deep black tone of onyx creates a striking focal point, while the surrounding diamond accents enhance the visual brilliance of the overall composition.

Stud earrings are appreciated for their balanced structure and versatility, offering a refined style that can complement both everyday wear and formal occasions.

Sunburst Design Structure

The sunburst motif radiates outward from the central gemstone, forming a pattern that resembles rays extending from a focal point. This design approach adds movement and dimension to the earrings while keeping the center stone visually prominent.

Sunburst-inspired jewelry designs are often chosen for their ability to frame a gemstone in a decorative yet structured arrangement that enhances overall brilliance.

Black Onyx and Diamond Contrast

Black onyx is valued for its smooth surface and bold color, making it a distinctive gemstone in modern jewelry designs. Its dark tone creates a strong visual contrast against the sparkle of surrounding diamonds.

Diamond accents add brightness and light reflection to the design, producing a balanced combination of depth and brilliance that highlights the center stone.

A Distinctive Stud Earring Style

Stud earrings with decorative motifs offer a refined alternative to minimal gemstone studs. By combining a bold center stone with a radiating pattern of accent stones, the sunburst structure introduces both visual texture and symmetry.

This combination of gemstone contrast and structured design creates earrings that emphasize both elegance and distinctive visual character.

Product Information
SKU SHP-EARRINGS0621113944
Metal Weight 2.20 gm (Approximate)
Total Stone Weight 0.52 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 2 Pieces
Total Weight 0.44 Carat (Approximate)
Dimension(approx) Round-4X4 mm-2 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.08 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade SI
View More

Product Parent Collection Handle
black-onyx-earrings

FAQs About: 1/2 CT Round Shape Black Onyx and Diamond Sunburst Stud Earrings

What is a sunburst jewelry design?
A sunburst design features a central gemstone surrounded by elements that radiate outward like rays, creating a decorative and structured appearance.
What makes black onyx distinctive in jewelry?
Black onyx is known for its deep black color and smooth surface, which creates strong contrast when paired with brighter gemstones such as diamonds.
Why are stud earrings popular?
Stud earrings are popular because they sit close to the ear and offer a balanced, versatile design that can complement many different styles and occasions.
How do diamonds enhance gemstone earrings?
Diamonds add brightness and sparkle that contrast with the center gemstone, helping highlight the focal stone while increasing the overall brilliance of the design.
What occasions are onyx earrings suitable for?
Onyx earrings are often worn for both everyday styling and formal occasions because the bold gemstone color pairs easily with a variety of jewelry styles.