Round Cut Peridot Lotus Flower Pendant for Women

0
Regular price $339
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add some meaning and beauty to your jewelry collection with this gorgeous Lotus Pendant. Featuring a lovely Lotus Flower design, this piece represents growth, strength, and fresh starts. At the heart of the Lotus is a stunning 3 MM Round Shape Peridot set in Bezel Setting, the birthstone for August, shining in a deep green hue that really draws attention. The vibrant color combined with the floral motif gives off an elegant and uplifting vibe. Hanging from a sleek chain and secured with a lobster clasp, this Natural Peridot Necklace sits comfortably on your neckline and is perfect for all-day wear. Whether you dress it up with casual wear or elevate it with a fancy outfit for a special event, this Flower Pendant Necklace brings a gentle splash of color and a meaningful element. This August Birthstone Necklace comes beautifully packaged in a jewelry box, making it a thoughtful birthday gift, especially for August borns, or a delightful surprise for anyone who appreciates nature-inspired designs.

Product Information
SKU SHP-PENDANT092022346
Length 18.5 mm
Width 15 mm
Metal Weight 4.00 gm (Approximate)
Total Stone Weight 0.16 Carat (Approximate)
PERIDOT INFORMATION
No.of Stones 1 Pieces
Total Weight 0.16 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
peridot-necklaces