Natural London Blue Topaz Designer Eternity Band with Diamond

0
Regular price $399
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This elegant London Blue Topaz Eternity Band combines contemporary design with traditional brilliance, making it an ideal selection for any woman who appreciates geometric aesthetics. Showcasing a sequence of alternating baguette cut London Blue Topaz and round shape Diamonds, each encased in striking hexagonal frames, this Half Eternity Band Ring forms a distinctive geometric arrangement that reflects light beautifully from all perspectives. All london blue topaz stones boasts AAA quality white diamonds boasts HI-SI quality. Engineered for comfort and suitable for daily wear, the Blue Topaz Wedding Band is slender enough to be stacked with other rings yet sufficiently bold to make a statement on its own. Whether used as a wedding band, an anniversary present, or a fashionable statement piece, it effortlessly complements any occasion. The Wedding Anniversary Ring is available in a comprehensive range of sizes and is presented in a sophisticated jewelry box, accompanied by a certificate of authenticity to ensure a seamless and reliable shopping experience. Carefully designed to merge uniqueness with timeless elegance, this London Blue Topaz Ring is a significant and adaptable addition to any jewelry collection.

Product Information
SKU SHP-RINGS032225923
Metal Weight 1.60 gm (Approximate)
Total Stone Weight 0.40 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 2 Pieces
Total Weight 0.28 Carat (Approximate)
Dimension(approx) Baguette-2X4 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Baguette
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-9 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
london-blue-topaz-women-wedding-bands