Natural Emerald Butterfly Earring for Cartilage Piercing

0
Regular price $409
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This cartilage earring features a butterfly-inspired design accented with a natural emerald gemstone. The compact structure is created specifically for cartilage placement, allowing the decorative element to sit neatly along the upper portion of the ear.

Cartilage earrings are often selected for their refined scale and detailed design. The butterfly motif adds a symbolic and decorative element while the emerald introduces a distinctive green tone that draws subtle attention.

Butterfly Inspired Jewelry Design

Butterfly motifs are frequently used in jewelry as symbols of transformation and renewal. Their balanced wing structure lends itself naturally to small decorative pieces such as cartilage earrings.

In this design, the butterfly form is arranged to remain visually clear while maintaining a lightweight appearance suitable for cartilage placement.

Natural Emerald Gemstone

Emeralds are valued for their rich green color and long association with traditional jewelry craftsmanship. Their distinctive tone adds visual contrast within delicate designs.

Natural emerald gemstones form within the earth through geological processes, resulting in variations in tone and natural characteristics that contribute to each stone’s individuality.

Cartilage Earring Structure

Cartilage earrings are designed for placement in the upper ear rather than the earlobe. Their compact size allows decorative details to remain visible while maintaining a comfortable fit within cartilage piercings.

The butterfly design combined with an emerald accent creates a small yet visually expressive piece suited to modern ear styling.

Product Information
SKU SHP-BODYJ052210063
Length 4 mm
Width 5.2 mm
Height 1.5 mm
Metal Weight 0.26 gm (Approximate)
Total Stone Weight 0.10 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 4 Pieces
Total Weight 0.10 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-2 Pcs
Marquise-1.50X3.00 mm-2 Pcs
Color Green
Cut Brilliant
Shape Round, Marquise
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
helix-earrings

FAQs About: Natural Emerald Butterfly Earring for Cartilage Piercing

What is a cartilage earring?
A cartilage earring is designed specifically for piercings located in the upper part of the ear rather than the earlobe.
Why are butterfly designs used in jewelry?
Butterfly motifs are often associated with transformation and renewal, making them a popular decorative element in jewelry.
What makes emerald gemstones distinctive?
Emeralds are known for their vibrant green color and have long been valued in traditional and contemporary jewelry designs.
Can cartilage earrings be worn with other ear jewelry?
Cartilage earrings are commonly styled alongside studs, hoops, or other ear jewelry to create layered ear looks.
Are gemstone cartilage earrings popular?
Gemstone cartilage earrings are popular because they add color and decorative detail while remaining small and refined.
What makes small earrings suitable for cartilage piercings?
Cartilage jewelry is typically compact so it sits comfortably within the upper ear while keeping decorative elements visible.