Natural Diamond Promise Ring with Hidden Heart

0
Regular price $999
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Promise Marked by Subtle Meaning

The Natural Diamond Promise Ring with Hidden Heart is designed for those who value symbolism expressed through refined detail. Featuring a natural diamond center, this ring carries a discreet heart motif within its structure—visible upon closer look. It offers a meaningful alternative to traditional promise styles while maintaining a timeless, elegant profile.

Design & Hidden Heart Detail

The classic diamond presentation keeps the focus on brilliance and clarity, while the hidden heart element adds a personal dimension to the design. Positioned within the ring’s setting, the heart detail remains subtle, allowing the ring to appear refined from the top view while carrying deeper symbolism beneath.

Stone Character & Wear Considerations

Natural diamonds are valued for their durability and light performance. Each diamond may display individual characteristics that reflect its natural origin. With proper care and routine maintenance, this ring is suitable for regular wear. Removing jewelry during high-impact activities helps maintain its finish and structural integrity.

High-Level Features Buyers Consider

  • Natural diamond center: classic brilliance and enduring appeal.
  • Hidden heart design: subtle romantic detail within the setting.
  • Promise-ready style: refined silhouette suitable for everyday elegance.
  • Metal options available: select your preferred metal directly on the product page.
Product Information
SKU SHP-RINGS08191186
Width 6 mm
Height 5 mm
Weight 2.99 gm (Approximate)
Center Stone Weight 0.48 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 19 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-18 Pcs
Round-4X4 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-rings

FAQs About: Natural Diamond Promise Ring with Hidden Heart

Is the diamond in this ring natural?
Yes, this ring features a natural diamond center stone. Natural diamonds may show individual inclusions and characteristics.
What does the hidden heart detail represent?
The hidden heart symbolizes love and commitment in a subtle way, adding personal meaning without altering the ring’s refined appearance.
Is this ring suitable for daily wear?
Yes, natural diamond rings are commonly worn daily. Removing the ring during activities that may cause impact helps preserve its finish.
Can this ring be used as a promise or pre-engagement ring?
The design makes it well suited for promise, pre-engagement, or meaningful milestone gifting, depending on personal preference.
How should I clean and maintain this ring?
Clean gently with mild soap and warm water using a soft cloth. Avoid harsh chemicals and store separately when not in use.