Natural Diamond Infinity Earrings with Screw Back

0
Regular price $399
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Timeless Symbol in Diamond Form

These Natural Diamond Infinity Earrings are designed to represent enduring connection and elegance. The infinity motif offers a meaningful shape that blends symbolism with refined diamond sparkle.

Crafted for women who value both sentiment and sophistication, this pair delivers a graceful balance between design and everyday practicality.

Infinity Design with Secure Structure

The flowing infinity silhouette creates a continuous loop, enhanced with natural diamonds for added brilliance. The curved form introduces soft movement while maintaining a structured and balanced profile.

Designed with screw back closures, these earrings provide a secure fit that helps keep them comfortably in place throughout the day.

Natural Diamond Brilliance

Natural diamonds are prized for their durability and consistent sparkle, making them suitable for regular wear. Their placement along the infinity motif highlights the curves and enhances light reflection.

This combination of symbolic design and diamond detailing creates a refined and lasting piece of jewelry.

High-Level Features

This pair features a diamond-accented infinity design with screw back closures. The earrings are crafted to offer symbolic elegance, secure wear, and balanced proportions suitable for everyday styling.

Product Information
SKU SHP-EARRINGS032210367
Metal Weight 1.20 gm (Approximate)
Total Stone Weight 0.12 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-4 Pcs
Round-1.10X1.10 mm-4 Pcs
Round-1X1 mm-4 Pcs
Round-0.80X0.80 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stud-earrings

FAQs About: Natural Diamond Infinity Earrings with Screw Back

What does the infinity design symbolize?
The infinity symbol represents continuity and lasting connection, making it a meaningful choice for personal or gift jewelry.
How do screw back earrings improve security?
Screw back closures fasten by twisting into place, helping reduce the likelihood of accidental loosening during daily wear.
Are natural diamond infinity earrings suitable for everyday use?
Yes, natural diamonds are durable gemstones, and when securely set, these earrings are appropriate for regular wear.
Do screw back earrings feel comfortable?
When properly fitted, screw back earrings are designed to sit securely while maintaining everyday comfort.
How should I clean diamond infinity earrings?
Clean gently with mild soap and lukewarm water, using a soft brush to reach around the diamond settings and infinity curves.