Moissanite Star Crawler Earring for Helix Piercing

0
Regular price $509
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add a playful and stylish touch to your jewelry collection with the Moissanite Star Earring. This Unique Climber Earring is designed to stand out, combining celestial shape with sparkling stones for a piece that is both trendy and eye-catching. At the center of the design is a star shaped motif, fully studded with round cut moissanites. Enhancing the star, additional round cut moissanites are clustered in prong setting, adding extra sparkle and giving the earring a constellation-inspired feel. The design is perfect for anyone who loves jewelry that is a little different and full of personality. The Moissanite Crawler Earring can be worn on multiple piercings, including the helix, cartilage, or upper lobe, making it versatile and fun to style. The flat back closure ensures a secure fit while keeping the Moissanite Cartilage Earring sleek against your ear. Crafted with hallmarked metal, the Star Helix Earring has a durable finish that keeps it looking shiny and elegant for everyday wear. It comes beautifully packaged in a jewelry box and includes a certificate of authenticity, making it a ready-to-gift piece for birthdays, holidays, or just as a fun treat for yourself.

Product Information
SKU SHP-BODYJ042210145
Metal Weight 0.90 gm (Approximate)
Total Stone Weight 0.18 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 12 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-5 Pcs
Round-1.40X1.40 mm-1 Pcs
Round-1.50X1.50 mm-1 Pcs
Round-1.80X1.80 mm-5 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
helix-earrings