Minimalist Moissanite Infinity Promise Ring

0
Regular price $319
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

The Moissanite Infinity Promise Ring is designed for a bond that feels quietly certain. Two round moissanite stones rest within a graceful infinity knot, creating a soft symbol of two hearts, two souls, or two meaningful paths staying connected. Its slim 2.5 mm band and refined 6 mm design height give the ring a delicate presence, making it a thoughtful choice for a promise, proposal, anniversary, milestone gift, or a personal reminder of lasting love.

With its smooth flowing form and subtle sparkle, this ring carries emotion without feeling overly ornate. The design feels modern and intimate, offering a meaningful alternative to traditional promise rings while still giving the brilliance and sentiment shoppers look for in fine jewelry.

Minimalist Moissanite Infinity Promise Ring with Round Brilliant Cut Stones

This moissanite ring features two white round moissanite stones in a brilliant cut, secured in a prong setting within an infinity-inspired design. The total moissanite weight is approximately 0.12 carat, with each round stone measuring approximately 2 x 2 mm. The promise ring is available in 92.5 sterling silver, 10K gold, 14K gold, and 18K gold options in white or yellow tones, allowing buyers to choose the metal that best suits their style, budget, and gifting intention.

What Makes This Special

This ring is centered around a meaningful infinity silhouette, making it more than a simple gemstone ring. The two-stone layout gives the design emotional balance, with each moissanite representing a shared connection, promise, or personal milestone.

The ring includes 2 pieces of round white moissanite with a total approximate weight of 0.12 carat. The stones are brilliant cut for a bright, lively sparkle and are placed in a prong setting to keep the design open, light-catching, and refined.

Its approximate 2.30 gram weight, 2.5 mm width, and smooth profile make it easy to wear while still offering enough detail to be noticed. The minimalist scale helps it pair well with daily jewelry, stacked rings, or a simple solo look.

Why Choose This Design

The infinity design is ideal for shoppers who want a ring with emotional depth but prefer a clean, wearable style. Unlike larger statement rings, this promise ring keeps the focus on symbolism, comfort, and everyday beauty. The flowing knot shape softens the look of the band, while the two moissanite stones add a refined sparkle that does not overpower the design.

Round brilliant cut moissanite is a strong choice for a promise ring because it offers noticeable fire and brightness in a compact size. The prong setting helps light reach the stones from multiple angles, enhancing the sparkle while keeping the overall ring delicate and graceful. Its available metal choices also make it suitable for different personal styles, from the cool polish of sterling silver or white gold to the warmer character of yellow gold.

Design Meaning

The infinity motif represents love without an endpoint, making this ring a meaningful symbol of commitment, devotion, friendship, or a personal journey. The two stones bring another layer of sentiment, reflecting two people, two promises, or two moments that belong together.

As a promise ring, it speaks softly but clearly. It can mark the beginning of a future together, celebrate a relationship that continues to grow, or honor a connection that has already proven its strength. For self-gifting, the same design can represent resilience, continuity, and the choice to carry something meaningful every day.

Authenticity & Craftsmanship

This infinity ring is made to order and crafted with careful attention to stone placement, setting security, and finish. The D-VS1 moissanite is set by hand in a prong setting to support both sparkle and stability. Each order is beautifully presented in an elegant jewelry box combined with our authenticity certification, giving buyers added confidence in the stone details.

As with all fine jewelry, gentle care helps preserve its appearance. Remove the ring before heavy work, harsh chemical exposure, or abrasive cleaning, and store it separately when not in use to protect the metal and stones from unnecessary wear.

Style and Wearability

The ring has a soft, minimal look that works well for everyday wear, office styling, romantic occasions, and meaningful gifting. From the top, the infinity shape frames the two moissanite stones with gentle movement and from the side, the modest design height keeps the ring refined and easy to style.

It can be worn alone as a delicate promise ring or paired with simple bands for a more personalized stack. Its metal options make it easy to match with existing jewelry, while its symbolic design makes it especially suitable for birthdays, anniversaries, proposals, commitment moments, and heartfelt surprise gifts.

Product Information
SKU SHP-RINGS0821189108
Width 2.5 mm
Height 6 mm
Weight 2.30 gm (Approximate)
Center Stone Weight 0.12 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Round-2X2 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
infinity-rings

FAQs About: Minimalist Moissanite Infinity Promise Ring

What makes this ring suitable for a proposal or promise gift?

This ring is well suited for a proposal, promise, or commitment gift because it combines two meaningful elements: an infinity design and two round moissanite stones. The infinity motif expresses lasting connection, while the two stones can represent two people or two hearts joined by a shared promise.

What does the infinity design symbolize?

The infinity design symbolizes love, commitment, and connection without an endpoint. In this ring, the flowing knot shape makes it especially meaningful for relationships, anniversaries, friendship promises, personal milestones, or a reminder of a bond that continues to grow.

What stone cut and setting style are used in this ring?

This infinity symbol ring features round brilliant cut white moissanite stones. The stones are secured in a prong setting, which helps keep the design refined while allowing light to reach the moissanite for visible sparkle.

Does this ring have a solitaire focus or accent stones?

This is not a solitaire ring. It features two round moissanite stones set within the infinity design. The two-stone layout gives the ring a balanced, symbolic look rather than a single center-stone focus.

What metal options are available for this ring?

This moissanite ring is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold. These choices allow buyers to select a cool-toned or warm-toned metal based on preference.

Is this moissanite ring authenticated?

Yes. The ring comes beautifully packaged in a jewelry box along with a certificate of authenticity that clearly states the moissanite quality grade is D-VS1.

Is the Minimalist Moissanite Infinity Promise Ring suitable for daily wear?

Yes, its slim 2.5 mm width, minimalist profile, and gentle infinity shape make it suitable for regular wear. To help preserve the ring, remove it before heavy work, harsh chemical exposure, swimming, or abrasive cleaning, and store it separately when not being worn.