Emerald Cut Lab Grown Emerald Eternity Wedding Band

0
Regular price $220
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Select Your Ring Size (US)
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

The everlasting charm of the Lab Grown Emerald Band Ring showcases a captivating design, symbolizing dedication and devotion as a commitment to your beloved. It boasts a continuous row of 3X5 MM emerald cut lab created emerald stones set in a shared prong setting, handcrafted in 14k yellow gold plated silver. Striking the perfect balance between sophistication and versatility, this Emerald Cut Emerald Band radiates understated brilliance and timeless allure, making it an exquisite choice for weddings, anniversaries, or birthdays. Representing a style of eternity, this Emerald Cut Wedding Band embodies a timeless and distinctly feminine grace that can be styled endlessly. Beautiful and captivating, this AAAA quality Lab Grown Emerald features a bold, sharp geometric motif, making it a truly unique piece of jewelry for any occasion. Wear it solo for a chic, understated vibe, or layer it with other rings for a trendy, stacked look. Its adaptable design goes well with both contemporary and traditional jewelry. Made with attention to detail, this Emerald Wedding Band is comfy enough for everyday use and designed to endure. It arrives in high-quality packaging and comes with a certificate of gemstone authenticity, perfect for gifting or keeping for yourself.

Product Information
SKU RCRI122035962-FBA
Width 3.4 mm
Height 5 mm
Weight 3.00 gm (Approximate)
Center Stone Weight 7.20 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 24 Pieces
Total Weight 7.20 Carat (Approximate)
Dimension(approx) Emerald Cut-3X5 mm-24 Pcs
Color Green
Cut Brilliant
Shape Emerald Cut
Setting Type Shared Prong
Quality Grade AAAA
View More

Product Parent Collection Handle
eternity-rings