Diamond Bar Tragus Earring with Black Enamel

0
Regular price $509
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Sharp, sleek, and quietly expressive, this diamond bar tragus earring brings a modern edge to curated ear styling. Round diamonds are arranged across a slim gold bar in a pave setting, while black enamel adds a graphic contrast that makes the design feel bold without overpowering the ear. Made for piercings such as tragus, helix, cartilage, rook, conch, or upper lobe, it is a refined choice for someone who likes body jewelry with a distinctive finish and a polished diamond accent.

Bar Tragus Earring with Black Enamel and Round Diamonds

This tragus earring combines 10 round brilliant cut natural diamonds with a clean bar silhouette and black enamel detailing. The diamonds have an approximate total weight of 0.06 carat, HI color, and SI quality grade. Available in 10K, 14K, and 18K yellow or white gold, with selectable flat back post lengths and left or right ear options, it is designed for a customized fit in a modern piercing stack.

What Makes This Special

The slim gold bar design gives this piece a structured, contemporary look, while the black enamel creates a strong visual line that sets it apart from classic diamond body jewelry.

The earring includes 10 round diamonds, each approximately 1X1 mm, arranged in a pave setting for a continuous touch of sparkle across the bar.

With an approximate diamond weight of 0.06 carat and an approximate earring weight of 0.45 gm, the design stays lightweight while delivering a crisp, high-contrast finish for tragus and cartilage styling.

Why Choose This Design

A bar earring works especially well for curated ear looks because it adds clean direction and shape. The straight silhouette feels minimal, while the pave diamonds bring refined light and the black enamel adds depth and contrast.

The pave setting keeps the round diamonds closely arranged for a smooth, sparkling surface. Flat back post length options make the earring easier to personalize for different piercing placements, helping it sit neatly in the ear without distracting from the design.

Design Meaning

The bar motif represents clarity, direction, and strength, making this earring a meaningful choice for someone drawn to clean lines and confident details. The black enamel gives the piece a bold, self-assured attitude, while the diamonds soften the look with controlled sparkle. Together, the design feels expressive, modern, and personal.

Authenticity & Craftsmanship

This earring is carefully crafted with attention to diamond placement, enamel detailing, secure pave setting, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product, giving added confidence with your purchase. Before dispatch, each piece goes through stone inspection, setting security review, and finishing inspection. To care for it, avoid harsh chemicals, perfumes, and chlorine, store it separately, and clean gently with a soft cloth after wear.

Style and Wearability

This single diamond bar earring is made for styling with intention. Wear it in a tragus piercing for a bold focal point, place it along the helix or cartilage for a sleek linear accent, or pair it with simple studs and hoops for a layered ear stack. Yellow gold adds warmth against the black enamel, while white gold gives the design a cooler, sharper finish. The left and right ear options help the bar align naturally with the chosen piercing placement.

Product Information
SKU SHP-BODYJ052210003
Weight 0.45 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.06 Carat (Approximate)
Dimension(approx) Round-1X1 mm-10 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
tragus-earrings

FAQs About: Diamond Bar Tragus Earring with Black Enamel

What stones are used in the Diamond Bar Tragus Earring with Black Enamel?

This earring features 10 round natural diamonds with an approximate total weight of 0.06 carat. The diamonds are brilliant cut, HI color, SI quality grade, and set in a pave setting.

What makes the design different from a simple diamond tragus earring?

The design combines a slim gold bar, pave set round diamonds, and black enamel detailing. This gives the earring a modern, high-contrast look rather than a traditional solitaire or plain stud style.

Can this earring be worn in piercings other than the tragus?

Yes. This bar earring can be styled on helix, cartilage, rook, tragus, conch, or upper lobe piercings, depending on the wearer’s piercing placement and fit preference.

Is this earring sold as a single piece or a pair?

This earring is sold singly, making it suitable for one-ear styling, asymmetric ear stacks, or pairing with other cartilage and tragus earrings.

What metal options are available for this diamond bar tragus earring?

This earring is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold.

Does this earring come with flat back post length options?

Yes. Flat back post length options include 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm, allowing the wearer to choose a fit suited to the piercing.

How should I care for the black enamel and diamond details?

Keep the earring away from harsh chemicals, perfumes, chlorine, and abrasive cleaners. Store it separately and wipe it gently with a soft cloth after wear to help protect the enamel finish and diamond setting.