Certified Cubic Zirconia Flower Cluster Engagement Ring

0
Regular price $1,029
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by natures beauty, this Flower Engagement Ring adds a romantic glow to your most cherished moments. At the heart of this captivating design is a delicate cluster of high-quality round cut cubic zirconia stones, skillfully arranged to create a blooming flower that sparkles from every angle. The outcome is a ring that feels both fresh and timeless - just right for those who appreciate elegance with a whimsical twist. The floral motif gives this Cluster Engagement Ring a graceful and feminine touch, embodying the essence of love in full bloom. Meticulously crafted and built to last, this Cubic Zirconia Engagement Ring combines classic style with playful beauty, perfect for women who enjoy fine jewelry that feels personal and expressive. The dazzling zircons reflect light beautifully, providing an ethical, sustainable option without sacrificing shine. Presented in a charming jewelry box, it is ready to be gifted or treasured as a keepsake that symbolizes a love that keeps growing. Let this Statement Flower Ring serve as a lasting reminder that love, like flowers, flourishes with care and intention.

Product Information
SKU SHP-RINGS082213911
Width 9.5 mm
Height 2.8 mm
Metal Weight 2.08 gm (Approximate)
Total Stone Weight 0.74 Carat (Approximate)
ZIRCON INFORMATION
No.of Stones 25 Pieces
Total Weight 0.74 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-16 Pcs
Round-1.70X1.70 mm-8 Pcs
Round-1.90X1.90 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Cluster-Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
cubic-zirconia-engagement-rings