Certified 7X9 MM Oval Moissanite Wedding Drop Earrings with Screw Back

0
Regular price $170
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

In these Bridal Earrings, a 7X9 MM oval shaped moissanite takes center stage, beautifully framed by round cut moissanite halo and dangling from a decorative bar at the top. These Dangle Drop Earrings are further decorated with pear and marquise cut stones set to form a butterfly motif. Secure prongs gracefully holds each gemstone in place, enhancing its brilliance, while the screw back closure ensures the earrings sit safely on your earlobes, offering a flawless fit with every wear. Our Moissanite Wedding Earrings will add the perfect sparkle to your bridal glow as they are crafted in 14K White Gold Plated Silver.

Product Information
SKU RCEA072410032-FBA
Weight 3.37 gm (Approximate)
Center Stone Weight 5.14 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 112 Pieces
Total Weight 5.14 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-4 Pcs
Oval-7X9 mm-2 Pcs
Pear-2X3 mm-4 Pcs
Round-0.80X0.80 mm-56 Pcs
Round-1X1 mm-46 Pcs
Color White
Cut Brilliant
Shape Marquise, Oval, Pear, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More