Certified 3 Carat Moissanite Designer Necklace with Silver Chain

0
Regular price $150
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Graceful, radiant, and full of charm, this Moissanite Necklace Silver is the kind of piece that makes hearts skip a beat. At the center lies a stunning 8 MM cushion cut Moissanite stone that glows with unmatched brilliance and is set in secure prong setting. Framing this showstopper is a delicate halo of shimmering round cut stones. A cute butterfly motif preached at the top, its wings embedded with dainty stones and shaped in soft curves that feel both feminine and free-spirited. This Butterfly Pendant Necklace is a blend of romantic design and natures elegance. It is curated in 14k white gold plated silver, offering the luxury of gold with a modern and affordable twist. This Designer Pendant shines with D color VS1 clarity Moissanite stones, making it a smart and stunning choice for todays bride-to-be. Whether you are walking down the aisle, celebrating a birthday, anniversary, or simply treating yourself to something timeless, this Bridal Necklace for Wedding adds that perfect sparkle to your story. This Halo Necklace is beautifully presented in a signature jewelry box, making it a thoughtful and personal surprise that is ready to gift.

Product Information
SKU RCPE082410054-FBA
Weight 4.10 gm (Approximate)
Center Stone Weight 3.15 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 31 Pieces
Total Weight 3.56 Carat (Approximate)
Dimension(approx) Cushion-8X8 mm-1 Pcs
Round-1.10X1.10 mm-24 Pcs
Round-1.30X1.30 mm-4 Pcs
Round-2X2 mm-2 Pcs
Color White
Cut Brilliant
Shape Cushion, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More