5mm Black Onyx Floral Engagement Ring with Diamond Halo

0
Regular price $749
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This exquisite Halo Engagement Ring represents a harmonious combination of timeless sophistication and thoughtful craftsmanship. At its core lies a 5MM brilliant round cut Black Onyx, encircled by a halo of shimmering diamond stones that enhance its inherent luster. The halo design not only elevates the brilliance of the center stone but also imparts a radiant and opulent appearance from every perspective. What distinguishes this Classic Halo Ring is the meticulous attention to detail. The ring showcases a split shank style on both sides of the center, contributing additional charm and depth to the overall design. Upon closer inspection beneath the center stone, one can find a beautifully designed gallery embellished with a delicate floral motif. This Flower Engagement Ring serves as a timeless emblem of love and commitment. Whether for a proposal, anniversary, or a significant occasion, this Black Onyx ring stands as an unforgettable representation of your shared journey. Available in US sizes 3 to 13, we also provide a complimentary ring sizer to assist you in finding your ideal fit, ensuring a stress-free experience. Whether you are purchasing for your girlfriend, fiancée, wife, or mother, this floral ring is guaranteed to make a lasting impression.

Product Information
SKU SHP-RINGS0821195799
Width 8.7 mm
Height 4 mm
Metal Weight 3.34 gm (Approximate)
Total Stone Weight 0.93 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Round-2X2 mm-10 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
black-onyx-rings