2 Carat Oval Lab Grown Emerald Wedding Necklace with Diamond Flower

0
Regular price $250
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Let your love story shine through with this floral inspired Emerald Necklace. Crafted with care in 14K yellow gold plated silver, this piece brings together graceful design and meaningful detail, making it a beautiful choice for your big day, or any day you want to feel extra special. At the center of the design sits a 7X9 MM oval cut lab created emerald, secured with prong setting that allows it to gently catch the light. Above the center stone, a delicate floral motif blooms with round lab grown diamonds, adding a soft shimmer and a lovely romantic touch. The Emerald and Diamond Necklace is suspended from a polished, lightweight chain that drapes comfortably across the neckline. It is subtle enough to wear alone, yet detailed enough to stand out, especially for moments that call for something extra meaningful. Whether you are walking down the aisle, sharing a special evening, or simply dressing up for a quiet afternoon, this Emerald Flower Pendant adds a gentle glow and a touch of thoughtful elegance. Perfect as a Wedding Necklace for Bride, a gift for someone close, or a piece you treat yourself to. It comes beautifully presented in a signature jewelry box and includes a certificate of authenticity, so you can treasure it with confidence.

Product Information
SKU RCPE062510125-FBA
Weight 3.50 gm (Approximate)
Center Stone Weight 1.90 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 1.90 Carat (Approximate)
Dimension(approx) Oval-7X9 mm-1 Pcs
Color Green
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.15 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-10 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More