1.6 Carat Lab Created Tanzanite Engagement Ring with Celtic Design

0
Regular price $1,489
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Step into a vintage inspired look with this beautiful Lab Grown Tanzanite Engagement Ring, designed with antique charm and timeless detail. Embellished with a 7 MM round cut lab created tanzanite, set in prong setting. The wide band features delicate Celtic knot patterns that reflect old-world craftsmanship and traditional design. A beaded border runs along the edges of the band, adding texture and giving the Tanzanite Solitaire Ring an antique and heirloom-style appearance. These fine details create a ring that feels both historic and graceful. A special hidden touch makes this ring even more meaningful. Beneath the center stone rests a small surprise diamond set in a flower motif. This secret detail adds sparkle and makes the Tanzanite and Diamond Ring feel personal and unique. Perfect for those who love vintage looking jewelry, this Celtic Engagement Ring works beautifully as an engagement ring, anniversary gift, or meaningful keepsake. Its thoughtful design and classic style make it a piece you will enjoy wearing for years.

Product Information
SKU SHP-RINGS102026031
Width 6 mm
Height 7 mm
Metal Weight 4.11 gm (Approximate)
Center Stone Weight 1.60 Carat (Approximate)
LAB CREATED TANZANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 1.60 Carat (Approximate)
Dimension(approx) Round-7X7 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.05 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
tanzanite-engagement-rings