Vintage Inspired 1 Carat Lab Created Yellow Sapphire Necklace with Diamond Halo

0
Regular price $170
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add a ray of sunshine to your jewelry collection with this elegant and vibrant Yellow Sapphire Pendant Necklace. Crafted in yellow gold plated silver, this eye-catching piece features a glowing 5X7 MM emerald cut lab grown yellow sapphire, securely set in prongs and surrounded by a shimmering halo of round lab grown diamonds. Above the main stone, a delicate floral motif adds a playful touch, adorned with sparkling diamonds and a single bezel set round diamond at the center connects the emerald cut with the flower, creating a sweet and feminine detail. Both the AAAA quality lab grown yellow sapphire and EF color VS clarity lab grown diamonds are of exceptional quality, offering brilliant sparkle and bold color, all while being ethically made and eco-conscious. These sustainable gemstones make this Sapphire and Diamond Necklace not only beautiful, but also a choice you can feel good about. Dangling from a sleek chain, this Vintage Sapphire Necklace sits gracefully at the neckline, whether worn alone or layered with other pieces. Its blend of Vintage Art Deco charm and modern design makes it perfect for someone who loves timeless elegance with a fresh twist.

Product Information
SKU RCPE062510045-FBA
Weight 3.30 gm (Approximate)
Center Stone Weight 1.15 Carat (Approximate)
LAB CREATED YELLOW SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 1.15 Carat (Approximate)
Dimension(approx) Emerald Cut-5X7 mm-1 Pcs
Color Yellow
Cut Brilliant
Shape Emerald Cut
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 33 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-1 Pcs
Round-1.40X1.40 mm-1 Pcs
Round-1X1 mm-31 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More