Two Stone Infinity Stud Earrings with Created Blue Sapphire

0
Regular price $319
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Designed with a graceful infinity-inspired silhouette, these two stone stud earrings bring deep blue color and meaningful symbolism into a refined everyday jewel. Four round created blue sapphire stones are arranged in a poised prong setting, giving each earring a balanced sparkle that feels intimate, polished, and full of sentiment. Their infinity design makes them a thoughtful gift for anniversaries, birthdays, promises, milestones, or simply for someone who loves jewelry with personal meaning.

Two Stone Infinity Stud Earrings with Round Created Blue Sapphire

These stud earrings feature lab created blue sapphire stones in a round shape with a brilliant cut, selected in AAAA quality grade for a rich blue presence. The total gemstone weight is approximately 1.36 carats across 4 stones, with each stone measuring approximately 4 x 4 mm. A secure prong setting keeps the sapphires visually open, allowing the blue color and cut to stand out while preserving the clean, close-to-ear comfort of classic studs.

What Makes This Special

The design brings together the symbolism of infinity and the charm of blue sapphire in a compact stud earring style. Four round created blue sapphires form the two stone look, creating a paired-stone effect that feels meaningful without appearing heavy.

The earrings have an approximate product weight of 1.44 gm, making them suitable for those who prefer a refined, easy-to-wear profile. The prong setting adds definition around each stone while keeping the design light, graceful, and focused on the blue sapphire sparkle.

Available metal choices include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, giving buyers the flexibility to choose a finish that suits their style or gifting preference.

Why Choose This Design

The round brilliant cut brings lively reflection to the created blue sapphires, while the prong setting helps show more of each stone from the front. This makes the earrings a smart choice for shoppers who want noticeable gemstone color in a neat stud silhouette.

The infinity motif adds emotional depth without overwhelming the design, making the pair easy to wear with workwear, evening outfits, and layered jewelry looks. The two stone styling gives the earrings a gentle sense of connection, making them especially fitting for a loved one, a close friend, or a personal celebration.

Design Meaning

The infinity form is associated with lasting love, continuity, loyalty, and promises that do not fade. Paired with blue sapphire, a gemstone often chosen for its composed and meaningful blue color, the design carries a quiet message of devotion and emotional steadiness. These earrings can mark a relationship milestone, a personal achievement, or a heartfelt gift that says “always” in a subtle and wearable way.

Authenticity & Craftsmanship

Each pair is carefully crafted with attention to stone placement, setting security, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase. Before dispatch, the earrings go through stone inspection, setting security review, and finishing inspection to help ensure the piece is ready for gifting or personal wear. To preserve their finish and sparkle, store them separately, avoid harsh chemicals, and clean gently with a soft jewelry cloth as part of regular care.

Style and Wearability

These created blue sapphire infinity studs sit close to the ear, making them easy to style for daily wear while still carrying enough color for special occasions. Their blue stones pair well with neutral outfits, soft evening looks, and both white and yellow metal jewelry depending on the selected metal option. They make a meaningful gift for birthdays, September birthstone moments, anniversaries, promise celebrations, or anyone drawn to symbolic jewelry with a refined gemstone focus.

Product Information
SKU SHP-EARRINGS042171128
Weight 1.44 gm (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 4 Pieces
Total Weight 1.36 Carat (Approximate)
Dimension(approx) Round-4X4 mm-4 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
lab-created-blue-sapphire-earrings

FAQs About: Two Stone Infinity Stud Earrings with Created Blue Sapphire

What gemstones are used in these infinity stud earrings?

These earrings are set with lab created blue sapphire stones. The design includes 4 round stones with an approximate total gemstone weight of 1.36 carats.

What cut and setting style do the blue sapphires have?

The blue sapphires are round in shape with a brilliant cut. They are held in a prong setting, which helps keep the stones secure while allowing their blue color and sparkle to remain visible.

What does the infinity design symbolize?

The infinity design represents lasting love, connection, loyalty, and continuity. This makes the earrings meaningful for anniversaries, promise gifts, birthdays, milestones, or a personal reminder of an enduring bond.

Which metal options are available for these earrings?

These earrings are available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Are these earrings suitable for daily wear?

Yes, the stud style and close-to-ear profile make them suitable for regular wear. The approximate product weight is 1.44 gm, giving the earrings a refined and comfortable feel for everyday styling as well as special occasions.

Do these created blue sapphire earrings come with a certificate?

Yes, Rosec Jewels offers a Certificate of Authenticity with the product. Each pair also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for these blue sapphire stud earrings?

Store the earrings separately to avoid scratches, keep them away from harsh chemicals, and wipe them gently with a soft jewelry cloth after wear. For longer-lasting shine, remove them before swimming, exercising, or applying perfumes and lotions.