Solitaire Freshwater Pearl and Diamond Infinity Ring

0
Regular price $1,229
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Freshwater Pearl Infinity Ring with Subtle Diamond Sparkle

This Solitaire Freshwater Pearl and Diamond Infinity Ring brings together soft elegance and symbolic design. At the center of the ring sits a luminous freshwater pearl, admired for its natural beauty and gentle glow. The pearl forms the focal point of the design, creating a refined and graceful presence on the hand.

Complementing the pearl is an infinity-inspired band accented with diamonds. The flowing lines of the infinity motif introduce a meaningful element while adding delicate sparkle that enhances the ring without overshadowing the central pearl.

Infinity Design with Balanced Structure

The infinity symbol is incorporated into the ring’s band to create a continuous and flowing shape. This design element represents continuity and connection, making it a meaningful choice for jewelry given to celebrate special relationships or milestones.

The diamonds placed along the infinity form add subtle brilliance, helping define the curves of the design. Their placement highlights the structure of the motif while maintaining a balanced and elegant appearance.

The Natural Beauty of Freshwater Pearl

Freshwater pearls are valued for their soft luster and timeless appeal in fine jewelry. Their smooth surface and gentle radiance create a classic look that pairs beautifully with the sparkle of diamonds.

As a centerpiece, the pearl introduces a refined contrast to the infinity band, offering a design that blends traditional elegance with contemporary symbolism.

A Meaningful Ring for Elegant Occasions

The combination of pearl, diamonds, and the infinity motif creates a ring that feels both expressive and graceful. Its balanced design allows it to be worn comfortably for everyday moments while also serving as a thoughtful piece for meaningful celebrations.

Whether chosen as a gift or as a personal piece of jewelry, the ring offers a refined interpretation of timeless materials and symbolic design.

Product Information
SKU SHP-RINGS082217398
Width 7 mm
Height 8.5 mm
Metal Weight 2.80 gm (Approximate)
Center Stone Weight 7.48 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 7.48 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-4 Pcs
Round-0.90X0.90 mm-2 Pcs
Round-1.10X1.10 mm-8 Pcs
Round-1X1 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
pearl-rings

FAQs About: Solitaire Freshwater Pearl and Diamond Infinity Ring

What does an infinity ring symbolize?
Infinity rings are often associated with continuity, unity, and lasting connection. The infinity symbol represents something that has no beginning or end.
What makes freshwater pearls unique in jewelry?
Freshwater pearls are admired for their soft luster and natural beauty. Their smooth appearance and subtle glow make them a timeless choice in fine jewelry designs.
Why are diamonds added to a pearl ring?
Diamonds introduce delicate sparkle that complements the gentle luster of the pearl. The combination creates visual contrast while maintaining an elegant overall design.
Can a pearl ring be worn for special occasions?
Pearl rings are often chosen for special occasions because of their classic elegance. Their refined appearance pairs well with both formal and celebratory outfits.
Is a pearl and diamond ring suitable as a gift?
A pearl and diamond ring is frequently selected as a meaningful gift for anniversaries, birthdays, or other milestones because it combines timeless elegance with symbolic design.
Can this ring be styled with other jewelry?
Yes, pearl rings are versatile and can be paired with other jewelry pieces such as pearl earrings, diamond bands, or delicate necklaces for a coordinated look.