Round Moissanite Flower Promise Ring for Her

0
Regular price $949
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by natures beauty, this Flower Promise Ring adds a soft, romantic glow to your most cherished moments. At the heart of this captivating design is a delicate cluster of D-VS1 quality round cut moissanites, skillfully arranged to create a blooming flower that sparkles from every angle. The outcome is a ring that feels both fresh and timeless - just right for those who appreciate elegance with a whimsical flair. The floral motif gives this Minimalist Ring a graceful and feminine touch, embodying the essence of love in full bloom. Meticulously crafted and designed to endure, this Moissanite Promise Ring for Her merges classic style with playful beauty, perfect for women who enjoy fine jewelry that feels personal and expressive. The glimmering moissanites reflect light beautifully, providing an ethical, sustainable option without sacrificing shine. Presented in a charming jewelry box, it is ready to be gifted or treasured as a keepsake that symbolizes a love that keeps growing. Let this Moissanite Flower Ring serve as a lasting reminder that love, like flowers, flourishes with care and intention.

Product Information
SKU SHP-RINGS022150128
Width 4.5 mm
Height 7.5 mm
Metal Weight 2.30 gm (Approximate)
Total Stone Weight 0.48 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 7 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-6 Pcs
Round-4X4 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings