Round Moissanite Flower Earring for Helix Piercing

0
Regular price $559
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Turn everyday outfits into something special with this delicate Moissanite Flower Earring. The design features a delicate round cut moissanite stone in prong setting at the center, surrounded by tiny metal petals that form a graceful floral motif. Compact and elegant, it brings a feminine touch to your look. Designed for versatility, this Moissanite Stud Earring fits perfectly on helix, cartilage, conch, rook, or upper lobe piercings. You can wear it alone for a subtle statement or pair it with other studs and hoops for a fun, layered style that shows off your personality. The flower motif gives it a vibe while remaining sophisticated enough for any outfit. Comfort is key, and this Moissanite Helix Earring delivers. It is lightweight, easy to wear, and features a flat back closure that sits comfortably and keeps the earring secure all day. Whether you are running errands, heading to work, or going out for a night with friends, it stays in place without any fuss. Perfect for everyday wear or special occasions, this Flower Cartilage Earring blends modern style with timeless elegance. Its sparkling center stone catches the eye, while the delicate design adds a feminine charm.

Product Information
SKU SHP-BODYJ0921397164
Length 6.4 mm
Width 6.7 mm
Height 2.8 mm
Metal Weight 0.81 gm (Approximate)
Total Stone Weight 0.09 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.09 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
helix-earrings