Round Diamond Solitaire Star Cartilage Earring

0
Regular price $549
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Designed for a curated ear with a celestial touch, this round diamond solitaire star cartilage earring brings together a single natural diamond and two gold shooting stars. The round diamond adds a bright focal point, while the star motif gives the piece a playful, meaningful look for helix, tragus, cartilage, or upper lobe styling. Sold singly, it is a thoughtful choice for personal styling, festive gifting, milestone surprises, or anyone who loves symbolic jewelry with a little sparkle.

Star Cartilage Earring with Prong Set Natural Round Diamond

This star cartilage earring is crafted with one round natural diamond weighing approximately 0.09 carat. The diamond measures approximately 2.40 x 2.40 mm and is listed with brilliant cut faceting, HI color, and SI quality grade. Secured in a prong setting and finished with a flat back post option, the design combines diamond sparkle, gold shooting-star detail, and a secure cartilage-friendly profile.

What Makes This Special

The earring features one round diamond with an approximate weight of 0.09 carat. The stone measures approximately 2.40 x 2.40 mm, giving the design a delicate but visible diamond accent.

The diamond is natural, round in shape, brilliant cut, HI in color, SI quality grade, and secured in a prong setting. Two gold shooting stars bring a celestial design element around the solitaire diamond.

The earring has an approximate weight of 0.63 gm and is sold singly. Metal options include 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. Flat back post length options include 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm, with left ear and right ear selections available.

Why Choose This Design

The star motif gives this cartilage earring personality without making the design feel heavy. It adds a celestial accent to the ear, while the round diamond brings a refined point of light that works well with both simple studs and more expressive ear stacks.

The prong setting keeps the diamond visible and bright, and the flat back post supports comfortable wear in cartilage placements. The single-piece format makes it ideal for asymmetric styling, while the selectable ear side and post length options help tailor the look to your piercing.

Design Meaning

Stars often symbolize guidance, hope, dreams, and personal direction. In this cartilage earring, the two shooting stars add a sense of movement and optimism, while the round diamond brings a lasting sparkle to the center of the design. It is a meaningful choice for someone celebrating a new chapter, a personal wish, or a style that feels written in the stars.

Authenticity & Craftsmanship

Each earring is carefully crafted with attention to diamond placement, prong setting security, star detailing, flat back comfort, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase experience. Before dispatch, every piece goes through stone inspection, setting security review, and finishing inspection to help ensure it is ready for styling or gifting. For lasting care, store it separately, avoid harsh chemicals, and wipe it gently with a soft cloth after wear.

Style and Wearability

This diamond star cartilage earring brings a delicate celestial accent to helix, tragus, cartilage, and upper lobe piercings. Wear it alone for a small statement, or pair it with diamond studs, plain gold flat backs, tiny hoops, moon motifs, or other star jewelry for a layered ear story. Its lightweight feel, flat back post options, and single-ear format make it easy to style for everyday wear, festive looks, and meaningful gifting.

Product Information
SKU SHP-BODYJ082210138
Weight 0.63 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.09 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
cartilage-earrings

FAQs About: Round Diamond Solitaire Star Cartilage Earring

What makes this diamond star cartilage earring special?

The earring combines a round natural diamond with two gold shooting stars, giving it a celestial look with a refined diamond focal point. It is designed for cartilage styling and can also be worn in helix, tragus, or upper lobe piercings.

What diamond is used in this star cartilage earring?

The earring features one round natural diamond measuring approximately 2.40 x 2.40 mm. The diamond has an approximate weight of 0.09 carat.

What cut, color, and quality are listed for the diamond?

The diamond is round in shape with brilliant cut faceting. It is listed as HI color and SI quality grade.

What setting style and backing does this earring have?

The round diamond is secured in a prong setting. The earring is designed with flat back post length options, which help support comfortable wear in cartilage and other piercing placements.

Is this earring sold as a single piece or a pair?

This earring is sold singly. Left ear and right ear selections are available, making it suitable for one piercing or an asymmetric curated ear look.

What metal and post length options are available?

The earring is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. Flat back post length options include 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm.

How should I care for this diamond star cartilage earring?

Store the earring separately to help prevent scratches, avoid harsh chemicals, and wipe it gently with a soft cloth after wear. For deeper cleaning, use mild soap, lukewarm water, and a soft brush, then dry it carefully before storing.