Round Cut Genuine Ruby Flower Promise Ring

0
Regular price $1,299
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Drawing inspiration from the stunning beauty of nature, this Flower Promise Ring radiates grace and elegance. At its core is a 5 MM round cut real ruby, securely held in prong setting that allows its vibrant hue to shine. Flanking the ruby are metal petals surrounding the center gem to create a floral pattern, adding a touch of sparkle and natural charm. The floral motif gives this Ruby Proposal Ring a romantic vibe, making it ideal for anyone who adores jewelry inspired by the beauty of nature. The AAA quality ruby shines with a rich color, while the glowing metal provides bright and radiant brilliance that enhances the overall appearance. Together, they create a lovely balance of warmth and sparkle that catches the light with every movement. Meticulously crafted with care and precision, this Ruby Flower Ring is both timeless and contemporary, a piece that will always remain in style. It symbolizes love that flourishes and blooms, just like a flower. Elegant, meaningful, and full of charm, this Floral Ruby Ring is a wonderful way to celebrate life’s most beautiful moments.

Product Information
SKU SHP-RINGS082223756
Metal Weight 2.87 gm (Approximate)
Center Stone Weight 0.65 Carat (Approximate)
RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
ruby-engagement-rings