Round and Marquise Cut Moissanite Statement Flower Pendant

0
Regular price $1,449
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Statement Pendant with Floral Inspiration

This moissanite flower pendant is designed for those who appreciate expressive jewelry with a refined finish. The floral arrangement creates a soft yet noticeable presence, making it suitable for occasions where a statement piece is desired without overwhelming the overall look.

Its balanced proportions allow it to complement both minimal and more styled outfits with ease.

Thoughtful Use of Mixed Stone Cuts

The combination of round and marquise cut moissanite stones brings depth to the design. Round cuts enhance brilliance and light reflection, while marquise shapes add elongation and structure, forming the petal-like arrangement.

Together, they create a cohesive pattern that feels deliberate and visually balanced.

Designed to Sit Elegantly on the Neckline

The pendant is crafted to rest comfortably along the neckline, allowing the floral motif to remain the focal point. Its form ensures that it stays centered while maintaining ease of wear throughout the day.

This makes it a versatile choice for both occasional and regular use.

Moissanite as a Practical Alternative

Moissanite is valued for its durability and ability to reflect light effectively, making it suitable for jewelry worn frequently. It is created without traditional mining, though impact varies by production and energy source.

The result is a stone that offers visual brilliance while supporting a more contemporary approach to jewelry sourcing.

Versatility in Styling

The floral pendant design pairs easily with both simple chains and layered necklaces. It can be worn as a standalone statement or combined with other pieces for a more curated look.

Its design ensures it remains relevant across seasons and occasions.

Product Information
SKU SHP-PENDANT032213980
Length 21 mm
Width 16 mm
Weight 3.70 gm (Approximate)
Total Stone Weight 2.60 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 17 Pieces
Total Weight 2.60 Carat (Approximate)
Dimension(approx) Marquise-3X6 mm-8 Pcs
Round-2X2 mm-8 Pcs
Round-3X3 mm-1 Pcs
Color White
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

Faq About: Round and Marquise Cut Moissanite Statement Flower Pendant

What makes this pendant a statement piece?
The floral design combined with multiple stone cuts creates a visually distinct look that draws attention while remaining refined.
Why are both round and marquise cuts used?
Round cuts provide brilliance, while marquise shapes add structure and elongation, helping form a balanced floral pattern.
Is moissanite suitable for everyday wear?
Yes, moissanite is known for its durability and is suitable for regular use when cared for properly.
Does the pendant sit flat on the neck?
The design is intended to rest neatly along the neckline, allowing the pendant to stay centered and visible.
Can this pendant be layered with other necklaces?
Yes, it can be layered with simpler chains or worn alone depending on the desired styling.
Is this design suitable for gifting?
The floral motif and balanced design make it a thoughtful option for occasions such as birthdays, anniversaries, or celebrations.