Real Emerald and Diamond Cactus Stud Earrings

0
Regular price $989
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Playful charm meets fine craftsmanship in these adorable Cactus Stud Earrings. Inspired by nature, the design captures the shape of a cactus plant and transforms it into a stylish and eye-catching pair. Each Nature Inspired Earring is beautifully adorned with round shape emeralds and diamonds, secured in prong setting to highlight their brilliance and fine detailing. AAA quality real emeralds are placed along the center of the cactus motif, while HI-SI quality genuine diamonds accent the arms and base, creating a balanced and lively composition. Crafted with attention to comfort and durability, the pair features secure screw back closures to ensure a firm and reliable fit throughout the day. Their compact yet expressive design makes them perfect for everyday wear, casual outings, vacations, or even special occasions when you want something fun yet refined. Presented in a jewelry box, these Emerald and Diamond Earrings arrive ready for gifting. They make a thoughtful choice for birthdays, anniversaries, holidays, or simply as a sweet surprise for someone special. Suitable for women of all ages, the cactus design symbolizes resilience and warmth, adding a subtle meaning to their playful look. Blending creativity with fine materials, these Cute Stud Earrings offer a refreshing take on gemstone jewelry.

Product Information
SKU SHP-EARRINGS012148450
Length 10 mm
Width 6.5 mm
Metal Weight 1.80 gm (Approximate)
Total Stone Weight 0.30 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 8 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-8 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 28 Pieces
Total Weight 0.16 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-16 Pcs
Round-1.10X1.10 mm-6 Pcs
Round-1X1 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
emerald-earrings