Real Diamond Flower Stud Earrings with Screw Backs

0
Regular price $909
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Enhance your daily style with these stunning Diamond Flower Earrings that seamlessly blend the classic allure of a delicate floral motif with a contemporary and minimalist vibe. Crafted with great care, these Earrings feature Round Shape Diamonds set in Prong Settings, mimicking the floral design, providing a gentle sparkle and connecting your look to nature. The simple elegance of these Minimalist Earrings is a timeless theme that brings to mind innocence, joy, and fresh starts. They offer a subtle shimmer that captures attention without overwhelming your appearance. These Floral Earrings embody a touch of natural beauty fused with modern design. They attract attention without being too bold, adding a hint of refined sophistication. These minimal Flower Stud Earrings serve as a heartfelt expression of love and make a perfect gift for birthdays or just because, beautifully symbolizing hope and faith. An ideal addition to your jewelry collection, perfect for everyday wear.

Product Information
SKU SHP-EARRINGS032210257
Length 4.4 mm
Width 4.4 mm
Height 2.7 mm
Metal Weight 0.80 gm (Approximate)
Total Stone Weight 0.36 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.36 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-8 Pcs
Round-3X3 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-earrings