Pear Shaped 4 Carat Moissanite Dangle Drop Earrings for Wedding

0
Regular price $160
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Make your Wedding day look perfect with these Moissanite Drop Earrings, crafted with 14K White Gold Plated Silver. These earrings feature Y-shaped metallic frame studded with smaller Moissanite on top. A 7X10 MM Pear Shape Moissanite secured in Prong Setting is dropping down from the reverse Y Motif. These Drop Dangle Earrings feature the radiance of D-VS1 Quality Moissanite, which not only completes the look but also makes you feel like a queen when you walk down the aisle. These Earrings with Screw on Backs will stays on the place throughout the day and will be delivered to you in a Rosec Jewels signature jewelry box with the certificate of authenticity. These Moissanite Teardrop Earrings will make you feel like royalty, drawing attention and compliments no matter where you are. They are ideal for Valentines Day gifts for your girlfriend, first anniversary gifts for your wife, birthday gifts for her, or graduation gifts for your daughter. Embrace sophistication with these Moissanite Wedding Earrings for Brides that elegantly blend charm and timeless elegance. Crafted with ethically sourced, eco-friendly moissanite stones, these Bridal Drop Earrings are presented in premium packaging for a truly heartfelt unboxing.

Product Information
SKU RCEA072410016-FBA
Weight 4.10 gm (Approximate)
Center Stone Weight 4.49 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 46 Pieces
Total Weight 4.91 Carat (Approximate)
Dimension(approx) Pear-7X10 mm-2 Pcs
Round-1.10X1.10 mm-8 Pcs
Round-1.20X1.20 mm-14 Pcs
Round-1.30X1.30 mm-6 Pcs
Round-1X1 mm-16 Pcs
Color White
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More