Oval Cut 0.65 Carat Swiss Blue Topaz and Diamond Flower Necklace with Chain

0
Regular price $170
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elevate your look with the timeless charm of this beautifully handcrafted Swiss Blue Topaz Necklace. Designed to add a touch of romance and refined elegance, this piece is expertly crafted in 14K yellow gold plated silver, a perfect complement to your wedding day glow. At its center is a captivating 5X7 MM oval cut Swiss Blue Topaz securely held in prong setting. Delicately perched above the center stone is a graceful floral motif adorned with lab grown diamonds. Each petal is sculpted with precision, forming a soft, feminine silhouette that reflects the beauty of nature and the purity of your special day. Suspended from a fine silver chain, this Topaz and Diamond Necklace offers both beauty and comfort, lightweight enough to wear all day, yet striking enough to be the centerpiece of your bridal jewelry. As the birthstone for December, Swiss Blue Topaz also adds meaningful significance for winter brides or those celebrating special moments in this month. Whether worn as December Birthstone Necklace or chosen for its timeless allure, this topaz bridal necklace blends nature-inspired elegance with heirloom-quality craftsmanship. Presented in a signature jewelry box, it also makes a thoughtful gift for bridesmaids or a cherished keepsake for the bride herself.

Product Information
SKU RCPE062510010-FBA
Weight 2.80 gm (Approximate)
Center Stone Weight 0.65 Carat (Approximate)
SWISS BLUE TOPAZ INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Oval-5X7 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.06 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-10 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More