Oval 2.5 Carat Rhodolite Pendant Necklace with Diamond Flower

0
Regular price $150
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add a romantic touch of color and elegance to your bridal look with this beautifully handcrafted Rhodolite Garnet Necklace. Thoughtfully designed in 14K yellow gold plated silver, this Oval Locket Necklace exudes warmth, charm, and grace, perfect for the bride who wants her jewelry to reflect both style and statement. At the heart of the piece lies a rich 7X9 MM oval cut Rhodolite, set securely in prongs. Above the vibrant center stone sits a delicate floral motif adorned with round cut lab grown diamonds, adding a soft, nature-inspired sparkle. Each diamond-encrusted petal is finely crafted to create a beautiful floral shape that complements the vivid rhodolite below. The design blends vintage inspiration with a fresh, modern feel, creating a standout piece you will treasure forever. The Rhodolite and Diamond Necklace hangs from a fine, adjustable chain that secures with a lobster clasp, allowing you to wear it at your preferred length. Lightweight and comfortable, it is ideal for all-day wear, from your walk down the aisle to your dinner date. Whether you are a bride, gifting your bridesmaids, or simply looking for a keepsake with deep value, this Flower Necklace is a piece that tells a story of romance, strength, and timeless beauty. Complete with a signature jewelry box, it is ready to be gifted or cherished for years to come.

Product Information
SKU RCPE062510127-FBA
Weight 3.50 gm (Approximate)
Center Stone Weight 2.50 Carat (Approximate)
RHODOLITE INFORMATION
No.of Stones 1 Pieces
Total Weight 2.50 Carat (Approximate)
Dimension(approx) Oval-7X9 mm-1 Pcs
Color Red
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.15 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-10 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More