Nature Inspired Diamond Leaf Earrings with Screw Back

0
Regular price $1,949
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Inspired by the quiet grace of nature, these diamond leaf earrings bring organic beauty into a refined stud design. Each earring is shaped with a delicate leaf motif and set with round diamonds that create soft, sparkling movement across the form. Finished with screw back closures for secure wear, the pair makes a thoughtful gift for someone who loves nature-inspired jewelry, meaningful everyday sparkle, or a polished accent for brunches, date nights, celebrations, and special events.

Nature Inspired Leaf Earrings with Round Diamonds

These diamond stud earrings are crafted with 28 round natural diamonds, creating an approximate total diamond weight of 0.85 carat. The design includes two larger 4 mm round diamonds supported by smaller round diamond accents that shape the leaf-inspired silhouette. With brilliant cut HI-SI diamonds, prong settings, screw back closures, and metal options from sterling silver to 10K, 14K, and 18K gold, the pair offers graceful sparkle with a nature-led design identity.

What Makes This Special

The earrings feature 28 round diamonds with an approximate total weight of 0.85 carat. The diamond layout includes 4 round diamonds measuring approximately 1.10 x 1.10 mm, 10 round diamonds measuring approximately 1.20 x 1.20 mm, 8 round diamonds measuring approximately 1.30 x 1.30 mm, 4 round diamonds measuring approximately 1.50 x 1.50 mm, and 2 round diamonds measuring approximately 4 x 4 mm.

The diamonds are round in shape, brilliant cut, HI color, SI quality grade, and secured in prong settings. The leaf motif gives the pair a graceful nature-inspired profile, while the screw back closure helps support a secure and comfortable fit.

The pair has an approximate weight of 1.50 gm. Metal options include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Why Choose This Design

A leaf design gives diamond studs a softer, more expressive character than a simple round solitaire. The curved nature-inspired shape brings movement to the ear, while the mix of smaller and larger round diamonds creates visual texture and sparkle across the motif.

The prong setting keeps the diamonds visible and bright, allowing the brilliant cut stones to reflect light from different angles. The screw back closure adds wearing confidence, making the earrings practical for all-day styling while still feeling special enough for gifting and occasion wear.

Design Meaning

Leaves often symbolize growth, renewal, hope, and natural beauty. In these diamond earrings, the leaf motif becomes a meaningful reminder of personal growth, fresh beginnings, and quiet strength. The diamond sparkle adds a celebratory touch, making the pair especially fitting for birthdays, anniversaries, graduations, Mother’s Day, or a thoughtful self-gift.

Authenticity & Craftsmanship

Each pair is carefully crafted with attention to diamond placement, leaf-shaped detailing, prong setting security, screw back comfort, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase experience. Before dispatch, every piece goes through stone inspection, setting security review, and finishing inspection to help ensure it is ready to wear or gift. For lasting care, store the earrings separately, avoid harsh chemicals, and wipe them gently with a soft cloth after wear.

Style and Wearability

These diamond leaf earrings add a graceful sparkle close to the face while keeping the look refined and wearable. They pair naturally with diamond pendants, tennis bracelets, floral jewelry, leaf-inspired rings, and simple gold chains. Their secure screw back closure and lightweight approximate 1.50 gm design make them suitable for daily wear, office styling, dinners, special events, and meaningful gifting.

Product Information
SKU SHP-EARRINGS082310480
Weight 1.50 gm (Approximate)
Center Stone Weight 0.85 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 28 Pieces
Total Weight 0.85 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-10 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1.50X1.50 mm-4 Pcs
Round-4X4 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Nature Inspired Diamond Leaf Earrings with Screw Back

What makes these diamond leaf earrings a meaningful gift?

The leaf motif can symbolize growth, renewal, hope, and natural beauty, while the diamond accents add lasting sparkle. This makes the earrings a thoughtful gift for birthdays, anniversaries, Mother’s Day, graduations, or personal milestones.

How many diamonds are used in these earrings?

The earrings include 28 round diamonds with an approximate total weight of 0.85 carat. The design includes smaller round diamond accents along with 2 round diamonds measuring approximately 4 x 4 mm.

What cut, color, and quality are listed for the diamonds?

The diamonds are round in shape with brilliant cut faceting. They are listed as HI color and SI quality grade.

What setting and closure style do these earrings have?

The diamonds are secured in prong settings, which keep the stones visible and bright. The earrings are finished with screw back closures for a secure and comfortable fit.

What makes the leaf design special?

The leaf design gives the earrings a nature-inspired shape with soft curves and visual movement. It adds meaning and character to the diamond stud style, making the pair more distinctive than a simple solitaire earring.

What metal options are available for these diamond earrings?

This design is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, giving buyers several choices in metal tone and purity.

How should I care for these diamond leaf earrings?

Store the earrings separately to help prevent scratches, avoid harsh chemicals, and wipe them gently with a soft cloth after wear. For deeper cleaning, use mild soap, lukewarm water, and a soft brush, then dry them carefully before storing.