Nature Inspired Blue Sapphire Diamond Leaf Earrings

0
Regular price $959
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the beauty of nature, these Leaf Earrings bring a touch of the outdoors to your jewelry collection. The stunning 3X5 mm Pear Shape Blue Sapphire is slantly placed in Prong Setting over a delicate leaf motif, creating a graceful, flowing design that is as unique as it is timeless. Adorned with sparkling Diamond stones, the intricate details of the leaf catch the light with every movement. These Blue Sapphire Earrings are a perfect blend of vibrant color and subtle elegance, making them a must-have for anyone who loves nature-inspired beauty with a hint of glamour. The Screw Back Closure ensures a secure and comfortable fit, so you can wear these Blue Sapphire Diamond Earrings with confidence all day or night. Whether you are pairing them with a cocktail dress for an evening out or adding a touch of sophistication to your everyday wear, these earrings are as versatile as they are beautiful. Their nature-inspired design is perfect for those who appreciate the intricate beauty of the world around them. Presented in a signature jewelry box, these September Birthstone Earrings are ready to gift for any special occasion, whether it is a birthday, anniversary or simply a thoughtful surprise for someone you love.

Product Information
SKU SHP-EARRINGS042157575
Length 11.3 mm
Width 5.5 mm
Metal Weight 1.60 gm (Approximate)
Total Stone Weight 0.74 Carat (Approximate)
BLUE SAPPHIRE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.60 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 34 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-12 Pcs
Round-0.90X0.90 mm-22 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
blue-sapphire-earrings