Natural Pink Tourmaline and Diamond Wedding Necklace for Bride

0
Sale price $176 Regular price $220
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elegant, radiant, and unapologetically romantic, this Pink Tourmaline Necklace is a breathtaking statement piece crafted with timeless beauty in mind. Handcrafted in 14k yellow gold plated silver, the Teardrop Pendant showcases a captivating 5X7 MM pear shaped Pink Tourmaline as its centerpiece, set in secure prong setting. Surrounding the center stone is a shimmering arrangement of round lab grown diamonds, creating a classic teardrop shape that glows from every angle. The intricate design flows upward with a graceful, nature-inspired motif, featuring diamond studded leaf-like shapes, which add texture, femininity, and symbolic elegance to the overall piece. Suspended from a sleek, adjustable chain and fastened with a lobster clasp, this Bridal Necklace for Wedding offers flexibility in length and ensures a secure and comfortable fit throughout your big day and beyond. Designed for the bride who wants to make a statement, this Pink Tourmaline and Diamond Necklace is the epitome of sophistication and sentiment. A stunning wedding day heirloom and a meaningful piece to cherish forever, it is perfect for anniversaries, festive occasions, and every unforgettable moment in between.

Product Information
SKU RCPE062510021-FBA
Weight 3.00 gm (Approximate)
Center Stone Weight 0.60 Carat (Approximate)
PINK TOURMALINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.60 Carat (Approximate)
Dimension(approx) Pear-5X7 mm-1 Pcs
Color Pink
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 35 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-11 Pcs
Round-0.90X0.90 mm-8 Pcs
Round-1X1 mm-15 Pcs
Round-2X2 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More