Cute Diamond Open Heart Earring for Helix Piercing

0
Sale price $408 Regular price $469
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Delicate Sparkle for Helix Piercings

This Natural Diamond Open Heart Earring is thoughtfully designed for helix piercings, offering a refined way to add subtle brilliance to cartilage styling. The open heart silhouette delivers a light, airy look while maintaining a clear symbolic presence.

Its scale and structure make it suitable for curated ear combinations or as a meaningful standalone accent.

Open Heart Design in a Compact Form

The open heart motif represents affection and connection while maintaining a modern outline. Its minimal structure prevents visual heaviness, making it especially appropriate for helix placement.

Careful stone placement enhances the shape without overwhelming the ear’s natural contours.

Natural Diamond Detail

Natural diamonds add crisp brilliance to the heart outline, creating contrast against the metal framework. Their light performance enhances the design while preserving a clean, delicate profile suitable for cartilage jewelry.

With mindful care and proper cleaning, diamond accents maintain their sparkle over time.

High-Level Features

This helix earring features a natural diamond open heart design intended for cartilage piercing. The style emphasizes symbolic shape, refined sparkle, and balanced proportions for curated ear styling.

Product Information
SKU SHP-BODYJ052310060
Length 8 mm
Width 9 mm
Height 1.8 mm
Metal Weight 0.60 gm (Approximate)
Total Stone Weight 0.15 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 14 Pieces
Total Weight 0.15 Carat (Approximate)
Dimension(approx) Round-1.25X1.25 mm-1 Pcs
Round-1.20X1.20 mm-1 Pcs
Round-1.10X1.10 mm-12 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Natural Diamond Open Heart Earring For Helix Piercing

Is this earring specifically designed for helix piercings?
Yes, the design and proportions are intended for helix placement, making it suitable for cartilage wear.
Is this sold as a single helix earring or a pair?
Please refer to the product detail table to confirm whether it is sold as a single piece or as a pair.
Can this heart helix earring be styled with other cartilage jewelry?
Yes, its compact open heart design makes it suitable for pairing with studs, hoops, or other curated ear pieces.
Are natural diamonds durable for cartilage earrings?
Natural diamonds are known for their durability and are commonly used in fine jewelry, including pieces designed for cartilage wear.
How should I clean a diamond helix earring?
Clean gently with mild soap and lukewarm water using a soft cloth or brush, then dry thoroughly before wearing or storing.