Natural Diamond Leaf Earring for Helix Piercing

0
Sale price $454 Regular price $499
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Nature-Inspired Elegance for Helix Piercing

This natural diamond leaf earring is designed specifically for helix piercing, offering a refined and delicate aesthetic. The leaf-inspired form adds a subtle organic touch, making it a distinctive yet understated piece.

Its design suits those who prefer minimal jewelry with a meaningful visual element.

Leaf Motif with Fine Detailing

The leaf design introduces soft curves and natural symmetry, creating a graceful silhouette along the ear. Each detail is crafted to reflect light gently, enhancing the overall appearance without overpowering the look.

The structure is intended to complement the natural contour of the helix.

Natural Diamond Accents

Natural diamonds are valued for their clarity and enduring appeal, making them suitable for fine jewelry pieces. Their subtle brilliance enhances the leaf design while maintaining a balanced and refined finish.

The stones are placed to provide a delicate sparkle within the overall structure.

Comfortable Fit for Cartilage Wear

Designed with helix placement in mind, the earring offers a secure and comfortable fit. Its lightweight structure supports extended wear without compromising on style.

It can be worn alone or combined with other earrings for a layered ear look.

Product Information
SKU SHP-BODYJ0921397022
Length 6 mm
Width 6.5 mm
Height 1.7 mm
Weight 0.63 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.05 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
helix-earrings

FAQs About: Natural Diamond Leaf Helix Earring

What is a helix earring?
A helix earring is designed for cartilage piercings along the upper outer ear.
Is this earring suitable for everyday wear?
Yes, its lightweight design and secure fit make it suitable for daily use.
Does this earring require a specific piercing?
Yes, it is intended for helix or cartilage piercings rather than standard lobe piercings.
Can it be styled with other earrings?
Yes, it pairs well with studs or hoops for a layered ear styling look.
Are natural diamonds suitable for daily wear?
Yes, natural diamonds are durable and commonly used in everyday jewelry.
How should I care for this earring?
Clean gently with a soft cloth and avoid harsh chemicals to maintain its finish.