Natural Black Onyx Diamond Drop Earrings with Fish Hook

0
Regular price $699
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add a touch of graceful elegance to your look with these Black Onyx Drop Earrings, beautifully designed with a dainty leaf motif. Each earring features a lustrous 5 mm Round Shape Black Onyx gemstone set in Prong Setting that gently sways beneath a sparkling Diamond with Leaf Motif, capturing the light with every movement. The natural contrast between the deep, rich AAA Quality Black Onyx and the bright shimmer of the HI-SI Diamond stones creates an effortlessly chic and timeless appeal. Delicately crafted with Fish Hook Closure, these Black Onyx Diamond Earrings are comfortable and perfect for adding a hint of sophistication to any outfit, whether you are dressing up for a romantic evening or adding polish to your everyday style. Presented in a beautiful jewelry box, these Black Onyx Earrings come ready to gift, making them a thoughtful choice for birthdays, anniversaries or simply to show someone special how much they mean to you. Elegant, feminine and full of charm, these Black and White Earrings are a stunning symbol of style, confidence and natural beauty.

Product Information
SKU SHP-EARRINGS112115543
Length 19 mm
Width 5.7 mm
Height 3.4 mm
Metal Weight 1.04 gm (Approximate)
Total Stone Weight 0.97 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 2 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Round-5X5 mm-2 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.07 Carat (Approximate)
Dimension(approx) Round-1.80X1.80 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More