Natural 1.7 CT Oval Aquamarine Flower Necklace with Lab Grown Diamonds

0
Sale price $238 Regular price $298
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Make your style bloom with the soft elegance of this beautifully crafted Aquamarine Necklace. Thoughtfully designed to bring a graceful, romantic touch to your jewelry collection, this piece is set in warm 14K white gold plated silver. At the center is a 7X9 MM oval cut aquamarine, nestled securely in prong setting. Above the gemstone sits a charming floral motif, adorned with round lab created diamonds. The Flower Pendant Necklace hangs from a sleek, high-polish chain that drapes beautifully along the neckline. It is lightweight, comfortable, and designed to sit just right, whether you are wearing it for a formal event, wedding, or simply enjoying a day out. This Aquamarine and Diamond Necklace is especially meaningful for those born in March, as aquamarine is the official birthstone of the month. Known to represent serenity and clarity, it makes a beautiful birthday gift, a symbolic piece of bridal jewelry, or a thoughtful gesture for someone special. Presented in a signature jewelry box and accompanied by a certificate of authenticity, this Wedding necklace for Bride is a keepsake.

Product Information
SKU RCPE062510123-FBA
Weight 3.50 gm (Approximate)
Center Stone Weight 1.70 Carat (Approximate)
AQUAMARINE INFORMATION
No.of Stones 1 Pieces
Total Weight 1.70 Carat (Approximate)
Dimension(approx) Oval-7X9 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.15 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-10 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More