Natural 0.6 Carat Ruby Diamond Heart Engagement Ring for Women

0
Regular price $1,629
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Captivate hearts and celebrate love with the enchanting Heart Engagement Ring, a sparkling symbol of romance and devotion. At its center lies a brilliant 5 mm Round Shape Ruby set in 4 Prong Diagonal Setting, radiating deep, passionate red hues that catch the light with every movement. Surrounding the gemstone, an Open Heart frame is gracefully adorned with dainty Diamond stones, adding a touch of shimmering elegance that enhances the charm of this Ruby Heart Ring. When worn, this Ruby Engagement Ring sits delicately on the finger, drawing attention to its refined design while reflecting the unique style of the wearer and the timeless nature of love. The Heart motif embodies affection, commitment and emotional connection, making it an ideal choice for a promise, engagement or a heartfelt gift to someone special. This Heart Shaped Engagement Ring comes in multiple ring sizes, ensuring the perfect fit and is presented in a signature jewelry box that enhances the joy of gifting. Whether marking a milestone, celebrating a cherished moment or expressing eternal devotion, the Ruby Diamond Engagement Ring transforms a simple gesture into a memory that lasts forever. A timeless treasure, it whispers love and admiration every time it sparkles under the light.

Product Information
SKU SHP-RINGS072210045
Metal Weight 2.90 gm (Approximate)
Center Stone Weight 0.65 Carat (Approximate)
RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type 4-Prong-Diagonal-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-18 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type 4-Prong-Diagonal-Setting
Quality Grade SI
View More

Product Parent Collection Handle
ruby-engagement-rings