Moissanite Heart and Paw Stud Earrings with Enamel

0
Regular price $639
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Playful Design with Meaningful Detail

The Moissanite Heart and Paw Stud Earrings with Enamel are created for those who prefer jewelry with personality and symbolism. The combination of heart and paw motifs brings together emotional connection and playful design in a compact stud format.

These earrings are ideal for buyers looking for a light, expressive piece that can be worn daily while still reflecting personal style.

Why the Heart and Paw Motif Works

The heart element introduces a familiar and symbolic shape, while the paw detail adds a distinctive and personal touch. Together, they create a design that feels both meaningful and visually engaging.

The use of enamel enhances the form by adding contrast and definition, allowing each element to stand out clearly within a small surface area.

Moissanite as a Practical Choice

Moissanite is known for its brightness and ability to reflect light, making it suitable for small-scale jewelry where clarity and sparkle are important. It offers a balanced appearance without overpowering the design.

Created without traditional mining, moissanite provides an alternative option, though its impact varies by production and energy source.

High-Level Features Buyers Appreciate

The stud format ensures a secure and close fit, making these earrings easy to wear throughout the day. Their compact size keeps them comfortable while still offering visible detail.

They can be worn alone for a subtle statement or combined with other earrings for a curated ear look, offering flexibility in styling.

Product Information
SKU SHP-EARRINGS012310001
Metal Weight 1.20 gm (Approximate)
Total Stone Weight 0.10 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 26 Pieces
Total Weight 0.10 Carat (Approximate)
Dimension(approx) Round-1X1 mm-24 Pcs
Round-0.80X0.80 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-earrings

FAQs About: Moissanite Heart and Paw Stud Earrings with Enamel

What does the heart and paw design represent?
The combination of heart and paw motifs often symbolizes love and connection, making it a meaningful design for personal expression.
Are these earrings suitable for everyday wear?
Yes, the stud design offers a secure and comfortable fit, making them appropriate for regular use with proper care.
What is enamel in jewelry?
Enamel is a decorative coating that adds color and detail to the design, enhancing contrast and visual clarity.
Is moissanite durable enough for daily use?
Moissanite is durable and maintains its appearance over time, making it suitable for everyday jewelry when handled with care.
Are these sold as a pair?
Stud earrings are typically sold as pairs, but it is recommended to confirm this in the product details section.
Who are these earrings best suited for?
These earrings are ideal for those who prefer playful, symbolic designs with subtle sparkle and everyday wearability.