Moissanite Floral Drop Earring for Helix Piercing

0
Sale price $452 Regular price $519
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Floral-Inspired Helix Earring with Subtle Movement

The Moissanite Floral Drop Helix Earring is designed for those who appreciate delicate detailing in curated ear styling. Its floral motif introduces a soft, nature-inspired element, while the drop feature adds gentle movement for added visual interest.

This piece is ideal for individuals seeking a refined yet expressive helix earring that stands out without appearing excessive.

Thoughtful Design for Helix Placement

Crafted to suit helix piercings, the structure follows the natural contour of the ear, helping ensure a secure and comfortable fit. The drop element is designed to hang with balance, avoiding unnecessary weight while enhancing the overall look.

The floral arrangement adds dimension without overwhelming the compact form of the earring.

Moissanite for Brightness and Everyday Wear

Moissanite is valued for its light-reflecting qualities, offering a bright and clear appearance. It is created without traditional mining, though its environmental impact varies by production and energy source.

This makes it a practical choice for those looking for a gemstone that balances visual appeal with modern sourcing methods.

High-Level Features Buyers Appreciate

The combination of a floral motif and drop design makes this earring suitable for both everyday wear and occasion styling. It can function as a standalone statement in a helix piercing or be layered with other earrings for a curated look.

Its balanced structure ensures it remains comfortable while maintaining a distinctive aesthetic.

Product Information
SKU SHP-BODYJ042210144
Metal Weight 0.90 gm (Approximate)
Total Stone Weight 0.53 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 8 Pieces
Total Weight 0.53 Carat (Approximate)
Dimension(approx) Pear-2.50X4.00 mm-1 Pcs
Round-2X2 mm-7 Pcs
Color White
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
helix-earrings

FAQs About: Moissanite Floral Drop Helix Earring

Is this earring suitable for helix piercings?
Yes, it is specifically designed for helix placement and follows the natural curve of the ear for a secure fit.
Does the drop design feel heavy?
The drop element is designed to be lightweight and balanced, allowing comfortable wear without pulling on the ear.
Can this earring be worn daily?
Yes, its compact and well-balanced design makes it suitable for regular wear.
What makes moissanite a popular choice?
Moissanite is appreciated for its brightness and clarity, offering a light-reflective appearance suitable for everyday jewelry.
Does this earring pair well with other earrings?
Yes, it works well with both minimal studs and other helix pieces for a layered ear styling look.
Who is this earring ideal for?
It is ideal for those who prefer delicate, nature-inspired designs combined with modern styling.