Modern Flower Pendant with Round Created Blue Sapphire and Diamond

0
Regular price $1,489
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Immerse yourself in the enchanting beauty of this mesmerizing contemporary flower pendant. Delicately crafted to captivate your gaze, this pendant showcases a breathtaking floral motif embellished with round Diamond and Created Blue Sapphire gemstones. The exquisite blend of these gems imparts a timeless charm, sure to garner attention wherever you go. Suspended by a radiant bale, this necklace pendant epitomizes glamorous allure, making it an ideal choice for those with a discerning fashion sense. Embrace the irresistible elegance and allure of this exquisite piece, destined to elevate any ensemble with a touch of glamour.

Product Information
SKU SHP-PENDANT032214556
Metal Weight 3.50 gm (Approximate)
Total Stone Weight 0.91 Carat (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 28 Pieces
Total Weight 0.26 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-4 Pcs
Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-8 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1X1 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-blue-sapphire-necklace