Minimalist Diamond Tragus Piercing Earring

0
Regular price $519
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Carry the beauty of minimal charm wherever you go with this exquisite Diamond Helix Earring, the epitome of elegance and style. The earring features genuine baguette shape diamond while dainty round diamonds studded on bar motif, exuding natural beauty, reminiscent of the elegance. The dainty Diamonds encrusted in a bar design, delicately enhance the radiance, adding a touch of sparkle and luxury. This stunning Baguette Diamond Earring is ideal for Helix, Cartilage, Tragus, or Upper lobe Piercings, it allows you to showcase your individuality. A heartfelt gesture to gift, that symbolizes love and elegance. The sleek flat back closure ensures a comfortable and secure fit, making it ideal for daily wear or special occasions. Whether worn alone as a statement piece or paired with other earrings, this Bar Earring adds a refined touch to any style. Each diamond is carefully selected for its HI color and SI clarity, giving the piece a radiant glow that enhances your natural elegance.

Product Information
SKU SHP-BODYJ082410090
Metal Weight 0.35 gm (Approximate)
Total Stone Weight 0.11 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.11 Carat (Approximate)
Dimension(approx) Baguette-1.50X3.00 mm-1 Pcs
Round-1.30X1.30 mm-4 Pcs
Color HI
Cut Brilliant
Shape Baguette, Round
Setting Type Prong-Setting
Quality Grade SI
View More