Minimalist Diamond Star Earring for Tragus Piercing

0
Sale price $417 Regular price $479
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Refined Detail for Tragus Styling

The Minimalist Diamond Star Earring for Tragus Piercing is created for those who prefer subtle expression in curated ear styling. The compact star motif offers delicate brilliance while maintaining a clean, balanced profile suited for cartilage placement.

Designed specifically for tragus wear, this piece complements both minimal and layered ear looks without overwhelming the piercing area.

Star Motif with Secure Structure

The star design introduces dimension through its defined edges and precise stone placement. Its small scale allows it to sit proportionately on the tragus, helping maintain visual balance.

The setting is structured to support secure wear in cartilage piercings. Exact measurements, backing type, metal options, and technical specifications are provided in the product detail tables above.

Diamond Characteristics for Cartilage Jewelry

Diamonds are selected for their clarity and light performance, making them suitable for fine, small-scale jewelry. When used in cartilage earrings, durability and secure setting design are essential for everyday comfort.

As a precious gemstone formed naturally, diamond durability supports long-term wear when handled and maintained appropriately.

High-Level Features

  • Minimalist star motif designed for tragus placement.
  • Diamond accents for subtle brilliance.
  • Structured setting for stable cartilage wear.
  • Complete specifications available in the product tables above.
Product Information
SKU SHP-BODYJ0921397174
Length 6.3 mm
Width 6.3 mm
Height 2 mm
Metal Weight 0.60 gm (Approximate)
Total Stone Weight 0.27 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 12 Pieces
Total Weight 0.27 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Round-2X2 mm-1 Pcs
Round-1.20X1.20 mm-5 Pcs
Round-0.80X0.80 mm-5 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
cartilage-earrings

FAQs about: Minimalist Diamond Star Earring for Tragus Piercing

Is this earring sold as a single piece or a pair?
Please refer to the product details and specification tables above to confirm whether the listing includes a single earring or a pair.
Is this suitable specifically for tragus piercings?
The design and scale are intended for tragus placement. Exact dimensions and post details are provided in the product specification tables to help ensure compatibility.
What type of backing does this earring use?
The backing style and closure mechanism are specified in the product detail tables above for accurate reference.
Can this be worn daily?
With proper care and secure fastening, this earring is designed for regular wear in cartilage piercings. Individual comfort may vary depending on piercing placement.
How do I confirm the metal type?
Available metal options and finishes are listed in the product configuration area and detailed in the specification tables above.